DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and l(3)80Fg

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:193 Identity:58/193 - (30%)
Similarity:79/193 - (40%) Gaps:59/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSD 119
            :|....|  .|.||.||:.|.|...:|::||.:||||:|||..|.|..| .||.::..|||:|:|
  Fly    22 IHVCSSL--NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-EKFIQIKLAYEILAD 83

  Fly   120 EQKRREYDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTN 184
            ..:||.:|.||.:..|                       |..|:...|..|..|       |..|
  Fly    84 LDRRRIFDRYGVSDIN-----------------------SQYFQKKHDYSEYNR-------FTLN 118

  Fly   185 SFDDFADSKFGFGQAQEMVMDLTFAQ-------------AARGVNKDVNVNVV----DQCPKC 230
            ..||      .|||..::..|:.|.|             .::...|   |:||    |.|.||
  Fly   119 QNDD------DFGQRFDIKQDIAFYQKLSITENYFEKMILSKNAKK---VHVVMFYNDWCFKC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 56/185 (30%)
DnaJ 65..127 CDD:278647 29/61 (48%)
DnaJ_zf 227..287 CDD:199908 3/4 (75%)
DnaJ_C 288..409 CDD:199909
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 30/64 (47%)
DnaJ 30..91 CDD:278647 29/61 (48%)
TRX_DnaJ 134..244 CDD:239261 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.