DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnajb1b

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b / 327244 ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio


Alignment Length:389 Identity:105/389 - (26%)
Similarity:159/389 - (40%) Gaps:104/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126
            :.||||:.||:.|.|:..:|||||.:.|.|||||.|| ...|..||:|::|||:||||.:|:..|
Zfish     1 MGKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNK-SAGAEEKFKEIAEAYDVLSDPKKKDIY 64

  Fly   127 DTYGQTAENIGRQG--GGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDF 189
            |.:|:       :|  ||.||||.|     |.:.::.|:.  ||..:|.:.||    ..|.|:..
Zfish    65 DRFGE-------EGLKGGAPGGGGG-----GGNYTYTFQG--DPHAMFSEFFG----GRNPFEHI 111

  Fly   190 ADSKFGF--GQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTG- 251
                ||.  |..:.|..|..||....|                                  |.| 
Zfish   112 ----FGHNGGMDENMETDDLFASFGMG----------------------------------GIGG 138

  Fly   252 ----FETVSTG--------PFVMR----STCRYCQGTRQHIKYPCSECEGKGRTV--QRRKVTVP 298
                |.|.|.|        |.|:.    |......|..:.:|.........|||.  :.:.:||.
Zfish   139 FPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTGCTKKMKISRKRLNPDGRTTRSEDKILTVE 203

  Fly   299 VPAGIENGQTVRM---------QVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTV 354
            |..|.:.|..:..         .:.:..:|| .:.:....::|:|:|:...|.|:|.:|:.|..:
Zfish   204 VKKGWKEGTKITFPREGDETPSNIPADVVFV-LKDKPHPVYKRDGSDIIYPAKITLKEALCGCVI 267

  Fly   355 RVQGVYEDQWIN------VEPGTSSHHKIMLRGKGLKRVNA-HGHGDHYVHVKITVPSAKKLDK 411
            .|. ..:.:.:.      |.||.    |..|.|:||....: ...||..|..::..|  :||.:
Zfish   268 NVP-TLDGRTVKVTSQDIVRPGM----KRRLTGEGLPLPKSPDRRGDLVVEYEVRFP--EKLSQ 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 105/388 (27%)
DnaJ 65..127 CDD:278647 32/61 (52%)
DnaJ_zf 227..287 CDD:199908 11/76 (14%)
DnaJ_C 288..409 CDD:199909 30/138 (22%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 105/389 (27%)
DnaJ 4..65 CDD:278647 32/61 (52%)
DnaJ_C 160..322 CDD:199909 35/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.