DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajb5

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:377 Identity:113/377 - (29%)
Similarity:162/377 - (42%) Gaps:79/377 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRRE 125
            ::.||||..||:...||..:|||||.::|.|||||.||| |:|..||:|::|||:||||.:||..
  Rat    72 VMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PNAEEKFKEIAEAYDVLSDPKKRSL 135

  Fly   126 YDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFD-DF 189
            ||.||:.    |.:.||...||:||        |:.:....||...|...||    .:|.|| .|
  Rat   136 YDQYGEE----GLKTGGGTSGGSGG--------SFHYTFHGDPHATFASFFG----GSNPFDIFF 184

  Fly   190 ADSK-----FGFGQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNG 249
            |.|:     .||....   ||:...:...|.......|.:.:.|:.|.....|..|         
  Rat   185 ASSRSTRPFSGFDPDD---MDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRK--------- 237

  Fly   250 TGFETVSTGPFVMR---STCRYCQGTRQHIKYPCSECEGKGRTVQRR----------------KV 295
                 |...|.|..   |......|:.:.:|.........||||:..                |:
  Rat   238 -----VQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKI 297

  Fly   296 TVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVY 360
            |.|     :.|......:.:..:|| .:.:...:|||:|.:|...|.|||.:|:.|.||.:..: 
  Rat   298 TFP-----KEGDATPDNIPADIVFV-LKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTI- 355

  Fly   361 EDQWIN------VEPGTSSHHKIMLRGKGL--KRVNAHGHGDHYVHVKITVP 404
            :.:.|.      ::|||...    |||:||  .:|... .||..|..|:..|
  Rat   356 DGRVIPLPCNDVIKPGTVKR----LRGEGLPFPKVPTQ-RGDLIVEFKVRFP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 113/375 (30%)
DnaJ 65..127 CDD:278647 35/61 (57%)
DnaJ_zf 227..287 CDD:199908 10/62 (16%)
DnaJ_C 288..409 CDD:199909 37/141 (26%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 113/377 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.