DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajb13

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001005885.1 Gene:Dnajb13 / 308857 RGDID:1359131 Length:316 Species:Rattus norvegicus


Alignment Length:380 Identity:104/380 - (27%)
Similarity:162/380 - (42%) Gaps:98/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126
            :..||||.|.|.:|:....|||||.:||.|.|| ....:|.|...|::::|||:||||..||..|
  Rat     1 MGMDYYAVLQVNRNSEDAQIKKAYRKLALKNHP-LKSNEPTAPEIFRQIAEAYDVLSDPVKRGIY 64

  Fly   127 DTYGQTAENIGRQGGGFPGGGAGGFGPE-GFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFA 190
            |.:|:.         |..||....||.: .::..:.|..  :||::|.:.|| |:   |.|.:|.
  Rat    65 DKFGEE---------GLKGGIPLEFGSQTPWTTGYVFHG--NPEKVFHEFFG-GD---NPFSEFF 114

  Fly   191 DSKFGFGQAQEMVMDLTF-AQAARGVNK-------DVNVNVVDQCPKCAGTKCEPGTKPGRCQYC 247
            |       |:...:||.| ....|||.|       |:.:::.|....|  ||   ..|..| :..
  Rat   115 D-------AEGNDIDLNFGGLRGRGVQKQDPPIERDLYLSLEDLFFGC--TK---KIKISR-RVL 166

  Fly   248 NGTGFE--------TVSTGPFVMRSTCRYCQGTRQHIKYPCSECEG-KGRTVQRRKVTVPVPAGI 303
            |..|:.        |:...|       .:.||||  |.:   |.|| :|..:        :||.|
  Rat   167 NEDGYSSTIKDKILTIDVRP-------GWRQGTR--ITF---EKEGDQGPNI--------IPADI 211

  Fly   304 ENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVE 368
                          :|:. :.:....||||..::.....|.|.:|:...||.|: ..:|:.:|:.
  Rat   212 --------------IFIV-KEKLHPRFRREQDNLFFVYPIPLGKALTCCTVEVK-TLDDRLLNIP 260

  Fly   369 PGTSSHHKI--MLRGKGL-------KRVNAHGHGDHYVHVKITVPSAKKLDKKRL 414
            .....|.|.  |:.|:|:       |:      ||.::...|..|:.....||::
  Rat   261 INDIVHPKYFKMVPGEGMPLPEDPTKK------GDLFIFFDIQFPTRLTPQKKQM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 104/379 (27%)
DnaJ 65..127 CDD:278647 29/61 (48%)
DnaJ_zf 227..287 CDD:199908 17/68 (25%)
DnaJ_C 288..409 CDD:199909 26/129 (20%)
Dnajb13NP_001005885.1 DnaJ 1..312 CDD:223560 104/380 (27%)
DnaJ 4..65 CDD:278647 29/61 (48%)
DnaJ_C 138..302 CDD:199909 46/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.