DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5504 and Dnajc10

DIOPT Version :9

Sequence 1:	NP_995932.1	Gene:	CG5504 / 48844	FlyBaseID:	FBgn0002174	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_001099956.2	Gene:	Dnajc10 / 295690	RGDID:	1307813	Length:	793	Species:	Rattus norvegicus

Alignment Length:	116	Identity:	39/116 - (33%)
Similarity:	64/116 - (55%)	Gaps:	28/116 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDT 128
            :::|:.|||:|.|:.::|::|:.:||.|.|||.|..:|:|...|.:::.|||||.||..|::||.
  Rat    34 QNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDK 98

  Fly   129 YGQTA--ENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFG 177
            ||:..  :|   |||.:              :||.:         :|..||
  Rat    99 YGEKGLEDN---QGGQY--------------ESWSY---------YRYDFG 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5504	NP_995932.1	DnaJ	63..437	CDD:223560	39/116 (34%)
		DnaJ	65..127	CDD:278647	26/61 (43%)
		DnaJ_zf	227..287	CDD:199908
		DnaJ_C	288..409	CDD:199909
Dnajc10	NP_001099956.2	DnaJ	34..>132	CDD:223560	39/116 (34%)
		DnaJ	35..97	CDD:278647	26/61 (43%)
		PDI_a_ERdj5_N	129..229	CDD:239301
		ER_PDI_fam	130..551	CDD:273457
		Trxb 1	235..350
		Trxb 2	348..463
		PDI_a_ERdj5_C	453..550	CDD:239302
		PDI_a_ERdj5_C	556..663	CDD:239302
		PDI_a_ERdj5_C	670..775	CDD:239302
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	790..793
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910