DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajb9

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_038788.2 Gene:Dnajb9 / 27362 MGIID:1351618 Length:222 Species:Mus musculus


Alignment Length:170 Identity:64/170 - (37%)
Similarity:88/170 - (51%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRRE 125
            |.:|.||..|||.|:|:.:.||||:::||.|||||.|| .|||..||:|::||||.|||...|:|
Mouse    22 LASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-SPDAEAKFREIAEAYETLSDANSRKE 85

  Fly   126 YDTYGQTA--ENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFR--KIFG--------- 177
            |||.|.:|  ...|::|.|.|           |.||:.|..    ::||:  ..||         
Mouse    86 YDTIGHSAFTNGKGQRGNGSP-----------FEQSFNFNF----DDLFKDFNFFGQNQNTRSKK 135

  Fly   178 --EGNFRT---------NSFDDFADSKFGFGQAQEMVMDL 206
              |.:|.|         :.|.:|:   ||.|...:|..|:
Mouse   136 HFENHFHTRQDGSSRQRHHFQEFS---FGGGLFDDMFEDM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 63/168 (38%)
DnaJ 65..127 CDD:278647 35/61 (57%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
Dnajb9NP_038788.2 DnaJ 26..87 CDD:278647 35/61 (57%)
Divergent targeting domain. /evidence=ECO:0000305 91..222 23/100 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.