powered by:
Protein Alignment CG5504 and DNAJC16
DIOPT Version :9
Sequence 1: | NP_995932.1 |
Gene: | CG5504 / 48844 |
FlyBaseID: | FBgn0002174 |
Length: | 520 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_056106.1 |
Gene: | DNAJC16 / 23341 |
HGNCID: | 29157 |
Length: | 782 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 41/75 - (54%) |
Similarity: | 54/75 - (72%) |
Gaps: | 1/75 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 DYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTY 129
|.|..|||::.|:..||||||.:||:::|||.|| ||.|..||.::|:|||:||:|:||..||.|
Human 29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNK-DPGAEDKFIQISKAYEILSNEEKRSNYDQY 92
Fly 130 GQTAENIGRQ 139
|...||.|.|
Human 93 GDAGENQGYQ 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0715 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.