DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnj-18

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:175 Identity:55/175 - (31%)
Similarity:81/175 - (46%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPD---TNKEDPDAGRKFQEVSEAYEVLSDEQKRRE 125
            :|:|..||:|::|:.||||.|||:|:|::|||   ||||  :|.:||.:|:.|||:||.|.||:.
 Worm    23 QDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKE--EAAKKFHQVAMAYEILSSEDKRKA 85

  Fly   126 YD-TYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSS----------ID------------ 167
            || |..:|:.        .|.      .|..||..::.|:|          ||            
 Worm    86 YDMTRIRTSP--------MPN------DPSSFSNRYRRRTSSNLKQYTDIDIDYKDFEHFQRSTR 136

  Fly   168 -----------PEELFRKIFGEGNFRTNSFDDFADSKFGFGQAQE 201
                       |.|.:.:.   |.|:...|      |..:.:|||
 Worm   137 RRPQYHSHFDMPNEFYAEF---GGFKKRVF------KSEYEEAQE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 55/175 (31%)
DnaJ 65..127 CDD:278647 34/64 (53%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 55/175 (31%)
DnaJ 23..>88 CDD:223560 35/66 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.