DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnj-4

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:111 Identity:37/111 - (33%)
Similarity:51/111 - (45%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDT 128
            :.:|..|||...|...:||.|:|..:||.|||.:.|: .|...|.|:..||:||.....||.|| 
 Worm    27 RTHYEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEE-SATASFLELKNAYDVLRRPADRRLYD- 89

  Fly   129 YGQTAENIGRQGGGFPGGGAGGFGPE-----GFSQSWQFRSSIDPE 169
                 ..:...||.:|.||.....|.     .||:.|....|.:|:
 Worm    90 -----YQLRGGGGRYPNGGQRYQYPNTAPQYDFSRDWSTYWSQNPD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 37/111 (33%)
DnaJ 65..127 CDD:278647 24/61 (39%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 37/111 (33%)
DnaJ 28..89 CDD:365959 24/61 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.