DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5504 and dnj-28

DIOPT Version :9

Sequence 1:	NP_995932.1	Gene:	CG5504 / 48844	FlyBaseID:	FBgn0002174	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_491084.1	Gene:	dnj-28 / 171870	WormBaseID:	WBGene00001046	Length:	494	Species:	Caenorhabditis elegans

Alignment Length:	138	Identity:	53/138 - (38%)
Similarity:	74/138 - (53%)	Gaps:	25/138 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 AGSGSTRADAPQVRRLHTTRDLLAK-DYYATLGVAKNANGKDIKKAYYQLAKKYHPDT---NKED 100
            :.:.:.|....|.:|   .::|:.| |||..|||.:|||.::|.|||.::|:|:|||.   .||.
Worm   357 SSNDAVRTGKDQAKR---AKELVGKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEK 418

  Fly   101 PDAGRKFQEVSEAYEVLSDEQKRREYDTYGQTA--ENIGRQGGG---------------FPGGGA 148
            ..|.:||.:::.|.||||:|:|||.:|. ||..  ...||.|||               |.|||.
Worm   419 KKAEKKFIDIAAAKEVLSNEEKRRAFDN-GQDPLDSEAGRGGGGGGGSHGFHNFHGFNPFGGGGG 482

  Fly   149 GGFGPEGF 156
            ||.|...|
Worm   483 GGRGGGDF 490

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5504	NP_995932.1	DnaJ	63..437	CDD:223560	49/115 (43%)
		DnaJ	65..127	CDD:278647	32/64 (50%)
		DnaJ_zf	227..287	CDD:199908
		DnaJ_C	288..409	CDD:199909
dnj-28	NP_491084.1	TPR_11	23..89	CDD:290150
		TPR repeat	28..52	CDD:276809
		TPR_1	<31..56	CDD:278916
		TPR repeat	57..87	CDD:276809
		TPR_9	78..136	CDD:290108
		TPR repeat	92..116	CDD:276809
		TPR_11	174..240	CDD:290150
		TPR repeat	175..203	CDD:276809
		TPR repeat	208..238	CDD:276809
		TPR repeat	291..321	CDD:276809
		TPR_11	294..356	CDD:290150
		TPR repeat	326..352	CDD:276809
		DnaJ	378..>445	CDD:223560	33/66 (50%)
		DnaJ	380..445	CDD:278647	32/64 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000