DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnajc18

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001096348.1 Gene:dnajc18 / 100124938 XenbaseID:XB-GENE-5795683 Length:483 Species:Xenopus tropicalis


Alignment Length:126 Identity:42/126 - (33%)
Similarity:65/126 - (51%) Gaps:22/126 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DAPQVRRLHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSE 112
            :|.:..||::.:: ...|||:.|||:|:||.:.::|||.:||.:||||.| ..|.|...|:.:.:
 Frog    95 EAEEEERLNSRKE-EEDDYYSLLGVSKDANEETVRKAYLKLALRYHPDKN-SSPGATETFKAIGK 157

  Fly   113 AYEVLSDEQKRREYDTYGQTAENIGRQG------------GGFPGGGAGGFGPEGFSQSWQ 161
            |:.||||..:|:.||.....|..:.:..            |.|||        ..|||.:|
 Frog   158 AFSVLSDPAQRKSYDDAQAKARVVSQPDLTTEDLFDLFFKGHFPG--------YAFSQQYQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 39/111 (35%)
DnaJ 65..127 CDD:278647 28/61 (46%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
dnajc18NP_001096348.1 DnaJ 111..172 CDD:306689 28/61 (46%)
Rho <213..>346 CDD:333130
DUF1977 375..473 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.