DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Catsup and Zip48C

DIOPT Version :9

Sequence 1:NP_524931.1 Gene:Catsup / 48805 FlyBaseID:FBgn0002022 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster


Alignment Length:303 Identity:69/303 - (22%)
Similarity:103/303 - (33%) Gaps:80/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LKVLLAFASGGLLGDAFLHLIPHATHPHSHGEHGHDHGHDHHHHHDGEEHEHGHSHDMSIGLWVL 229
            |...|.||:|.::..:|..|:..|.                      |..|..|.:.:...|.|.
  Fly    40 LDAALGFAAGVMIAASFWSLLKPAI----------------------EMAESSHLYGVYAFLPVA 82

  Fly   230 GGI----IAFLSVEKLVRIL----------------KGGHGGHGHSHGAPKPKPVPAKKKSS--- 271
            ||.    |.....:||:..|                |..............|..:.:|...|   
  Fly    83 GGFLLGSIFVYGCDKLMSYLGLNSTNMMIQMTQSKAKADIAIEDSKRNGVAPDRLASKSLDSFSD 147

  Fly   272 --DKEDSGDGDKPAKPAKIKSKK------PEAEPEGEVEISGY----LNLAADFAHNFTDGLAIG 324
              ..:.||:..:..|.|.|...:      ||.:...|..:|.:    |.:.|...||..:|||:|
  Fly   148 CLSVQHSGESRRRKKGASINEMEQCTYTTPEEQQRAEDALSQWKRIMLLVVAITVHNIPEGLAVG 212

  Fly   325 ASYLAGNSIGIVT-------TITILLHEVPHEIGDFAILIKSGCSRRKA--------MLLQLVTA 374
            .|:.|..|....|       .|.|.:...|..:.....|..:|.|.::|        |:..:...
  Fly   213 VSFGAIGSTNSSTFESARNLAIGIGIQNFPEGLAVSLPLHAAGFSVKRALWYGQLSGMVEPIFGV 277

  Fly   375 LGALAGTALALLGAGGGDGSAPWVLPFTAGGFIYIATVSVLPE 417
            |||:|.|...|:        .|:.|.|.||..|||.:..:|||
  Fly   278 LGAVAVTFANLI--------LPYALSFAAGAMIYIVSDDILPE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CatsupNP_524931.1 Zip 129..446 CDD:280666 69/303 (23%)
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 69/303 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.