DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Catsup and Slc39a13

DIOPT Version :9

Sequence 1:NP_524931.1 Gene:Catsup / 48805 FlyBaseID:FBgn0002022 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_038960439.1 Gene:Slc39a13 / 295928 RGDID:1304695 Length:395 Species:Rattus norvegicus


Alignment Length:355 Identity:122/355 - (34%)
Similarity:179/355 - (50%) Gaps:67/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WLHSIGSTLLISAAPFVLLYIIPLD-----NSEAMKPRLKVLLAFASGGLLGDAFLHLIPHA--- 188
            |:.|:..:|::..:....|.:|||:     .|||...|||.||:||.|||||:.||||:|.|   
  Rat    68 WICSLLGSLMVGLSGVFPLLVIPLEMGTMLQSEAGAWRLKQLLSFALGGLLGNVFLHLLPEAWAY 132

  Fly   189 THPHSHGEHGHDHGHDHHHHHDGEEHEHGHSHDMSIGLWVLGGIIAFLSVEKLVRILKGGHGGHG 253
            |...|.|..|                 ........:||||:.|.:.||::||:....|       
  Rat   133 TCNISPGVEG-----------------QSLQRQQQLGLWVIAGFLTFLALEKMFLNCK------- 173

  Fly   254 HSHGAPKPKPVPAKKKSSDKEDSG-----DGDKPAKPAKIKSKK-------PEAEPEGE------ 300
                ...|...|:|..::...:.|     ...:|...|.:::.|       |......|      
  Rat   174 ----EEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGPCGPPSCSCRAEWLTQLC 234

  Fly   301 ----------VEISGYLNLAADFAHNFTDGLAIGASYLAGNSIGIVTTITILLHEVPHEIGDFAI 355
                      :::||||||.|:...|||.|||:.||:|....||::||:.|||||:|||:|||||
  Rat   235 LPGSAWLSPLIQVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAI 299

  Fly   356 LIKSGCSRRKAMLLQLVTALGALAGTALALL--GAGGGDGSAPWVLPFTAGGFIYIATVSVLPEL 418
            |:::|..|..|..||..||||.|.|...|:.  ...|.:.:..|.||||:|||:|:|.|:|||:|
  Rat   300 LLRAGFDRWTAAKLQFSTALGGLLGACFAICTQSPKGVEETVVWTLPFTSGGFLYVALVNVLPDL 364

  Fly   419 LEESTKLKQSLKEIFALLTGVALMIVIAKF 448
            |||.... .||:::..|.:|:.:|::::.|
  Rat   365 LEEDDPW-HSLQQVLLLCSGIVVMVLLSLF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CatsupNP_524931.1 Zip 129..446 CDD:280666 121/351 (34%)
Slc39a13XP_038960439.1 Zip 65..390 CDD:396884 121/350 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D548499at33208
OrthoFinder 1 1.000 - - FOG0001345
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.