DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Catsup and Slc39a12

DIOPT Version :9

Sequence 1:NP_524931.1 Gene:Catsup / 48805 FlyBaseID:FBgn0002022 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_038951487.1 Gene:Slc39a12 / 291328 RGDID:1309305 Length:706 Species:Rattus norvegicus


Alignment Length:334 Identity:108/334 - (32%)
Similarity:144/334 - (43%) Gaps:76/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RHTKAKP------DLDMST--IWLHSIGSTLLISAAPFVLLYIIPLDNSEAMKPRLKVLLAFASG 174
            |..||||      ....||  :.|.::||.|   ....||.:    ...|.....|::.:..|.|
  Rat   352 RDQKAKPPPTTLEKYGYSTVAVTLLTLGSML---GTALVLFH----SCEENYSLILQLFVGLAVG 409

  Fly   175 GLLGDAFLHLIPHATHPHSHGEHGHDHGHDHHHHHDGEEHEHGHSHDMSIGLW----VLGGIIAF 235
            .|.|||.|||||.....|.                  :|.|.||.|:....:|    :||||..|
  Rat   410 TLSGDALLHLIPQVLGLHK------------------QEAELGHFHESQSPIWKLLGLLGGIHGF 456

  Fly   236 LSVEKLVRIL-----KG-----GHGGHGHSHGAPKPKPVPAKKKSSDKEDSGDGDKPAKPAKIKS 290
            ..:||...:|     ||     ||.||.|..|.           |.:..|...|.|..  :.|:.
  Rat   457 FLIEKCFILLVSPNTKGLPLVNGHAGHTHHLGL-----------SPELNDQSGGGKSI--STIQL 508

  Fly   291 KKPE----AE-PEGEVEIS----------GYLNLAADFAHNFTDGLAIGASYLAGNSIGIVTTIT 340
            |.||    || |:|.|..|          ..:.|..|..|||.|||.||.::.:....|:.|||.
  Rat   509 KGPEDSQTAELPKGNVPASNRNRKTISLLAVMVLVGDGLHNFADGLVIGTAFSSSLESGVTTTIA 573

  Fly   341 ILLHEVPHEIGDFAILIKSGCSRRKAMLLQLVTALGALAGTALALLGAGGGDGSAPWVLPFTAGG 405
            ||.||:|||:||||:|:.||.|.|.|:|:..::||.|..|..:. |..........|:|..|||.
  Rat   574 ILCHEIPHEMGDFAVLLSSGLSIRTAILMNFLSALTAFIGLYIG-LSVSADPRVQDWILTVTAGM 637

  Fly   406 FIYIATVSV 414
            |:|::.|.:
  Rat   638 FLYLSLVGM 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CatsupNP_524931.1 Zip 129..446 CDD:280666 103/317 (32%)
Slc39a12XP_038951487.1 ZIP4_domain 62..221 CDD:408101
Zip 368..646 CDD:396884 103/316 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.