DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Catsup and zipt-11

DIOPT Version :9

Sequence 1:NP_524931.1 Gene:Catsup / 48805 FlyBaseID:FBgn0002022 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_491614.1 Gene:zipt-11 / 172205 WormBaseID:WBGene00019077 Length:321 Species:Caenorhabditis elegans


Alignment Length:141 Identity:38/141 - (26%)
Similarity:56/141 - (39%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 KKPEAEPEGEVEISG---YLNLAADFAHNFTDGLAIGASYLAGNSIGIVT-------TITILLHE 345
            |:|:..||.:...|.   .|.:.|...||..:|||:|..:.:.......|       .|.|.|..
 Worm   156 KRPDVIPEEDYRQSWRRILLLILAVTVHNIPEGLAVGVGFGSAGKTKQATFESAFNLAIGIGLQN 220

  Fly   346 VPHEIGDFAILIKSGCSRRKA----MLLQLVTALGALAGTALALLGAGGGDGSAPWVLPFTAGGF 406
            .|..:.....|...|.|:.||    .|..:|..:.||.|.|..:.    .:...|:.|.|.||..
 Worm   221 FPEGLAVSLPLAAFGHSKLKAFWYGQLSGMVEPIAALFGAAAVIF----MEPVLPYALAFAAGAM 281

  Fly   407 IYIATVSVLPE 417
            ||:....::||
 Worm   282 IYVVVDDIIPE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CatsupNP_524931.1 Zip 129..446 CDD:280666 38/141 (27%)
zipt-11NP_491614.1 ZupT 5..321 CDD:223505 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.