DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and wdn

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:553 Identity:121/553 - (21%)
Similarity:190/553 - (34%) Gaps:147/553 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVPTSDWIYWCRLCARDDVVYKVRERDDDLVRIISKCFDVEMTLEEPELGSMLCEECYSVIGQLI 66
            |.||.        .|.|:::       ..|:||.:  ||...::::..|...| ..|.::....:
  Fly    30 GTPTK--------AAHDEIL-------SSLLRINN--FDSISSIKDESLDIDL-SACVTISSASL 76

  Fly    67 TFSDSVSKVQAIFELLRHSEPQDSQDLDALRLEYGLPPACKQDLEFLDIDDTEDRCSLVEELTIS 131
            ...:|:|... .:.:|..|    :|:...|.|.   ...|:.||.      .....::...||..
  Fly    77 VNGNSLSSTD-FWRVLDES----AQNNTELNLS---SDVCRDDLA------ATSSSTVPSTLTSD 127

  Fly   132 DHSTSPSPDFEAQTVRTRANLKQCNSDPKVLASPTASIPEVETKRSRRQQF--------AAKRNS 188
            :||:|   :|....:|........||..|..:|...|.|...:.....||.        ..:|..
  Fly   128 NHSSS---EFSVTFLRPEPPNAFTNSPFKKTSSSGTSTPVKLSPEQLHQQHQLQMPQSQLLQRKP 189

  Fly   189 KVYTAT-------------ESDDEEAILDE--------------------------DEAVSPPPL 214
            |:..||             |....|.::.:                          |.|..|||.
  Fly   190 KLPAATAVRLKVFKEEPPEEKHPPEQVVTKVEVCESELLPPSFTIFQQAKSAESVADAASMPPPA 254

  Fly   215 KRKRGRPKGSGKQKNVD--------DSDNVTSREPDDNAKSKQDDKTSELSMSPHGSQSSNFVDY 271
            ..:.       |...||        |.:.:....||:.||.:.......|:             |
  Fly   255 ASET-------KPLEVDPAPLHKCLDCNGLLLETPDEVAKHEAAAHRLRLT-------------Y 299

  Fly   272 PCKICNETFMSFMALRRH------------------------------KHDMHGGPKKYVCDHCG 306
            .|..|...|.....|::|                              ...:|...|||.||.||
  Fly   300 RCSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDCGKCLKLGSMWMHRKIHSDNKKYQCDICG 364

  Fly   307 KGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVHSQTHGEPK-FECNVCGKKLQTRAIL 370
            :......:|..|..:|:.|||..||.|...|:.::.|:.|.:.|.:.: :.|..|||..:|...|
  Fly   365 QKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCL 429

  Fly   371 NKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLRPYVCKYCGKAFASNTNCRSHKWKKHP 435
            ..|..||.::|.|.|.||.....:::.||.|...|||:||:.|.||.:.|.:..|     |.||.
  Fly   430 KVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPN-----WLKHT 489

  Fly   436 ELASKEDETESSRVP-VPTLEELRAITREMAKA 467
            ....|.|......:. :|:....::.|.:..||
  Fly   490 RRRHKVDHKTGEHLENIPSYCSKKSTTNKAQKA 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 12/68 (18%)
C2H2 Zn finger 273..294 CDD:275368 5/50 (10%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..429 CDD:275368 5/15 (33%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
RPB9 333..425 CDD:224510 25/91 (27%)
C2H2 Zn finger 333..352 CDD:275368 0/18 (0%)
zf-H2C2_2 344..369 CDD:290200 8/24 (33%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
zf-H2C2_2 372..395 CDD:290200 9/22 (41%)
zf-C2H2 386..408 CDD:278523 6/21 (29%)
C2H2 Zn finger 388..436 CDD:275368 14/47 (30%)
zf-H2C2_2 400..425 CDD:290200 7/24 (29%)
C2H2 Zn finger 416..433 CDD:275368 6/16 (38%)
zf-H2C2_2 429..453 CDD:290200 9/23 (39%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-H2C2_2 457..481 CDD:290200 12/23 (52%)
C2H2 Zn finger 472..493 CDD:275368 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.