DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and si:dkeyp-113d7.1

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_999959.1 Gene:si:dkeyp-113d7.1 / 407709 ZFINID:ZDB-GENE-030131-755 Length:498 Species:Danio rerio


Alignment Length:472 Identity:111/472 - (23%)
Similarity:172/472 - (36%) Gaps:109/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ERDDDLVRIISKCFDVEMTLEEPELGSMLCEECYSVIGQLITFSDSVSKVQAIFELLRHSEPQD- 89
            |.|.|.:|.:.  ..|...|...|||                 ||.:....:..:.::.....| 
Zfish    69 EPDLDPIRTVD--LSVIQPLSTAELG-----------------SDQIKMEISGLDYIKSEHHSDL 114

  Fly    90 ----SQDLDALRLEYGLPPACKQDLEFLDIDDTEDRCSLVEELTISD-HS----------TSPSP 139
                |.:|.:.:..|      :..|.|..|....|....::....|| ||          |...|
Zfish   115 HSFHSTELGSYKSHY------EPSLVFDYISHVSDSLEYIKSEHHSDLHSYYASELGTIKTEYEP 173

  Fly   140 DFEAQTVRTRAN------LKQCNSDPKVLASPTA--SIPEVETKRSRRQQFAAKRNSKVY--TAT 194
            .|....::|..|      :.:..::...|...|.  .|.::::..|         ::.:|  |:.
Zfish   174 IFMTSHIKTEMNGLESIHMAELRTELDKLRPETLIDGIGKLDSDFS---------SNSLYELTSV 229

  Fly   195 ESDDEEAILDEDEAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPDDNAKSKQDDKTSELSMS 259
            .::..:|...........|..||...|.|...........|.::.   .|.|:.:...|.|.   
Zfish   230 HANKAQAAHHPTSTKGHGPTPRKPRNPTGEKPFSCTQCGKNFSTL---GNLKTHKRIHTGER--- 288

  Fly   260 PHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHCGKGL--------------- 309
                      .|.|..|.::|.....|:||:. :|.|.|.|.|.||.||.               
Zfish   289 ----------PYTCSQCGKSFGQAGNLKRHQL-IHTGQKPYTCAHCPKGFTKADDLRSHQRLHTG 342

  Fly   310 ----------KTFTSLVE---HQLVHTEEKPCICPVCNAGFKNKARLRVHSQTH-GEPKFECNVC 360
                      |:|:...|   |||.||.|:|..|.:|...|..:...|.|.|.| ||..:.|:.|
Zfish   343 EKPFSCAECGKSFSQTKELKAHQLSHTGERPFCCSLCGKSFSKETSYRNHQQIHMGEKPYSCSQC 407

  Fly   361 GKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLRPYVCKYCGKAFASNTN 425
            ||......:|..|:.:|:.||.|.|..||........||.|...|||.|||.|:.|||.|:.:.:
Zfish   408 GKSFSNSGVLKTHEKIHSGERPFGCTQCGKHFGRLGHLKAHQQIHTGERPYTCQQCGKNFSQSGH 472

  Fly   426 CRSHKW---KKHPELAS 439
            .::|:.   ::.|:|:|
Zfish   473 LKAHEQIHKRERPDLSS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 11/53 (21%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 11/47 (23%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..429 CDD:275368 5/15 (33%)
si:dkeyp-113d7.1NP_999959.1 COG5048 <260..414 CDD:227381 44/170 (26%)
C2H2 Zn finger 264..284 CDD:275368 3/22 (14%)
zf-H2C2_2 276..299 CDD:290200 7/35 (20%)
C2H2 Zn finger 292..312 CDD:275368 6/20 (30%)
zf-H2C2_2 304..328 CDD:290200 12/24 (50%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 332..357 CDD:290200 2/24 (8%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
zf-H2C2_2 360..384 CDD:290200 10/23 (43%)
C2H2 Zn finger 376..396 CDD:275368 6/19 (32%)
zf-H2C2_2 388..413 CDD:290200 10/24 (42%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..452 CDD:275368 6/19 (32%)
zf-H2C2_2 444..469 CDD:290200 14/24 (58%)
C2H2 Zn finger 460..480 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.