DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and Phs

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster


Alignment Length:758 Identity:151/758 - (19%)
Similarity:231/758 - (30%) Gaps:311/758 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WIYWCRLCARDDVVYKVRERDDDLVRIISKCFDVE-------------MTLEEP----------- 48
            :||.|..|        ....||:|  |:|:.|.:|             ...|||           
  Fly   156 FIYSCTSC--------THHYDDNL--ILSRHFQLEHVEKSKRKRGKTKAAAEEPMVTPPLIIDPL 210

  Fly    49 ELGSM---------------LCEECYSVIGQLITFSDSVSKVQAIFELL-RHSEPQD-------- 89
            |:|.:               ||..|.|....::.|.:.:|:....|:|| ...||.|        
  Fly   211 EMGQLKPCAQLLVQGESVLQLCLACNSQFVDVVRFQEHLSQQHGYFQLLVPKEEPTDLPPHAMVT 275

  Fly    90 ---SQDLDALRLEYGLP-PA--------------------CKQDLEFLD---------------- 114
               :..|:....:..|| ||                    .|:||..::                
  Fly   276 IPGALALNKANAQLQLPIPAPETPPPEQDGKEAPPSNASNDKEDLTMINDMVAVIAAERVKKTSS 340

  Fly   115 -------------------------IDDTEDRCSLVEELTISDHSTSPSPDFEAQTVRTRAN--- 151
                                     :.|.:|.....::....:......|..|....:..:|   
  Fly   341 SKVNKMIIKLPMPKKRGRKRTKPESLRDEQDNAEKTDKKKKLNKEEGQQPVLEPLQAKKTSNQAE 405

  Fly   152 --LKQCNSDPKVLASP-------TASIPEVETKRSRRQQFAAKRNSKVYT--------------- 192
              ..|.|:..||..:.       |.|..:.||.....:.  |:.|||..|               
  Fly   406 NGATQSNNVVKVQQNAKGSKKDGTQSAQKSETNPKHLEN--AETNSKDNTESVALKETIHDKQLT 468

  Fly   193 -------ATESDD--EEAILDEDEA-------------------------VSPPP---LKRKRGR 220
                   .|:.||  .:..||:.||                         ::..|   .||||||
  Fly   469 IDEAGKAGTQKDDNSNQKQLDKSEANAGKSKMVDQVHQQMPVESAKDHQQMTEEPTNSTKRKRGR 533

  Fly   221 -----------PKGSGKQKNVDDSDNVTSR-------------------EPDDNAKSKQDDKTSE 255
                       |.|   .|.:.:...:..|                   |.||..:..:.|..|.
  Fly   534 KERKSPTPVLIPLG---DKEIKEEPELPERRMRKSRQHVDYVVEIKDEEEDDDEVEEAEVDDDSS 595

  Fly   256 LSMSPHGSQS-SNFVD-----------------YPCKICNETFMSFMALRRHKHDMHGGPKKYVC 302
            .::|||.|.: .:|..                 :.|..|.:||..|..::.|.. :|.|.|.|||
  Fly   596 ATISPHNSSTDESFTSIKRESSEESQHNGIGGIHTCNFCGKTFKRFSRMQDHLR-LHTGEKPYVC 659

  Fly   303 DHCGKGLKTFTSLVEHQLVHTEEKPCICPV----------------------------CNAGFKN 339
            ..||:..:....||||||.|..||...|.:                            ||.||..
  Fly   660 GQCGRAFRLKMRLVEHQLRHRAEKAYKCDICSMPLATKQDLSLHMRHHKNDRRYKCDKCNKGFVR 724

  Fly   340 KARLRVHSQTH-GEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHLL 403
            .:.|.:|.:.| ||..:.|::|||..:.|..|..|:..|..::..:||:|.........:::|:.
  Fly   725 SSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVHRRTHLGDKPIQCELCDKRFARKIDMRVHMR 789

  Fly   404 GHTGLRPYVCKYCGKAFASNTNCRSHKW----------------KKHPELASK-EDETESSRVPV 451
            .|||.:||.|..|.:.::|..|...|:.                |||.:.|:: |.|.|......
  Fly   790 RHTGEKPYNCDACQRGYSSRVNLLRHQEREHGIEEQVPGSGQADKKHTKTATENEQENEPKAKAA 854

  Fly   452 P------------------------TLEELRAITREMAKAKQD 470
            |                        :|..:..|..|.|:.|.|
  Fly   855 PRRPRREKLQQKIAAQEKLLNDLKRSLSAMPEIPEESAQVKLD 897

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 20/107 (19%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 9/19 (47%)
C2H2 Zn finger 330..350 CDD:275368 7/47 (15%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
zf-H2C2_2 397..422 CDD:290200 8/24 (33%)
C2H2 Zn finger 413..429 CDD:275368 4/15 (27%)
PhsNP_648789.3 COG5048 <594..787 CDD:227381 50/193 (26%)
C2H2 Zn finger 631..651 CDD:275368 6/20 (30%)
zf-H2C2_2 644..666 CDD:290200 9/22 (41%)
zf-H2C2_2 699..724 CDD:290200 4/24 (17%)
zf-C2H2 713..735 CDD:278523 6/21 (29%)
C2H2 Zn finger 715..735 CDD:275368 6/19 (32%)
zf-H2C2_2 727..750 CDD:290200 9/22 (41%)
C2H2 Zn finger 743..763 CDD:275368 7/19 (37%)
zf-H2C2_2 755..780 CDD:290200 6/24 (25%)
C2H2 Zn finger 771..791 CDD:275368 4/19 (21%)
zf-H2C2_2 783..808 CDD:290200 8/24 (33%)
C2H2 Zn finger 799..816 CDD:275370 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.