DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and CG4707

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster


Alignment Length:514 Identity:116/514 - (22%)
Similarity:176/514 - (34%) Gaps:127/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LCEECYSVIGQLITFSDSV----------SKVQAIFELLRHSE-----PQDSQDLDALRLEYGLP 103
            :|.||::.:.....|...|          ||.:.| |....:|     |..|.:||||...:..|
  Fly    49 VCRECWNCVSSFEEFHQRVSCLHRQRSSDSKSEPI-EFCGQTEEAIINPLYSVELDALAEAFFAP 112

  Fly   104 PACKQDLEFLD-------IDD---TEDRCS-----------------LVEELTISDHSTSPSPDF 141
            ...|.::..|:       ::|   ||.|.:                 :..||.:...|.:|..||
  Fly   113 SEVKVEVNELEPLPKVELLEDPVKTEIRTAPKRLGVPNEGSPHSKRRIKNELPVDSDSDAPLADF 177

  Fly   142 EAQTVRTRANLKQCNSDPKVLASPTASIPEVETKRSRRQQFAAKRNSKVYTATES---------- 196
                         .|||.|  .|........|..:.|:.:.:|:|........||          
  Fly   178 -------------LNSDSK--RSSVGPAKNSEANKGRQLRRSARRGRPPKAKPESAPSPKKELDS 227

  Fly   197 -DDEEAILDED--EAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPDDN---------AKSK- 248
             |.||...|.:  |.|:|..:.........|.:....|...::...||::.         .|.| 
  Fly   228 EDGEENARDNNDMEFVAPEAVLGTDDSSSSSSESSGEDSDHSLPDIEPEERYAEIPKRVVVKPKK 292

  Fly   249 ------------------------QDDKTSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRH 289
                                    |.|:..|:.:       ..|..:||.:||....:|..:|||
  Fly   293 YRKREKPLVPPVRLSREEIERRKLQQDEYDEIIL-------QFFKKFPCSLCNLLVQNFADMRRH 350

  Fly   290 KHDMHGGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVHSQTH---- 350
            :...|.....|: :.||:......:|.||.|||......:|..|...|::...|.||.|||    
  Fly   351 QRVSHNIESGYI-ECCGRKFHLRKALAEHVLVHKNPDHFMCSQCGRVFQDSRALEVHEQTHTNPE 414

  Fly   351 --GEPK----FECNVCGKKLQTRAILNKH---KYVHTDERRFKCEVCGSGCKNSTALKIHL-LGH 405
              .|||    ::|..|.|...|:|.:..|   |:|...|.::.|..|.........||.|| ..|
  Fly   415 VKAEPKEKRIYQCEKCPKSFTTKAAMEYHDVSKHVPKSEFKYSCPECNKKIPTERKLKEHLRYMH 479

  Fly   406 TGLRPYVCKYCGKAFASNTNCRSHKWKKHPELASKEDETESSRVPVPTLEELRAITREM 464
            ......:|..|||...|.||.:.|...:|.|....:.:.....:....|..|..:.:.|
  Fly   480 DPEAAIICDKCGKTLRSQTNLKKHHELEHSEKPRPKPDPVQCEICGTWLRHLSGLKQHM 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 8/35 (23%)
C2H2 Zn finger 273..294 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
C2H2 Zn finger 357..377 CDD:275368 7/22 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
zf-H2C2_2 397..422 CDD:290200 9/25 (36%)
C2H2 Zn finger 413..429 CDD:275368 7/15 (47%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071 5/23 (22%)
C2H2 Zn finger 334..355 CDD:275368 7/20 (35%)
LIM <361..407 CDD:295319 14/46 (30%)
C2H2 Zn finger 365..382 CDD:275368 6/16 (38%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 427..443 CDD:275368 5/15 (33%)
C2H2 Zn finger 458..476 CDD:275368 5/17 (29%)
C2H2 Zn finger 487..507 CDD:275368 8/19 (42%)
C2H2 Zn finger 521..540 CDD:275368 3/18 (17%)
C2H2 Zn finger 551..572 CDD:275368
C2H2 Zn finger 580..600 CDD:275368
C2H2 Zn finger 608..629 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.