DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and CG1663

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:187 Identity:48/187 - (25%)
Similarity:83/187 - (44%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 CKICNETFMSFMALRRHKHDMHGGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKPCICPVCNAGF 337
            |:.|:..|::...||.||..:||||...||..|.:.....:.|.:||                  
  Fly   201 CEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKLEQHQ------------------ 247

  Fly   338 KNKARLRVHSQTHGEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHL 402
                 .|.|.:   .|:::|:.|.....::....:|:.:|..:|.:.||:||...|.|:||.:|.
  Fly   248 -----ARYHFK---RPEWQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHR 304

  Fly   403 LGHTGLRPYV-CKYCGKAFASNTNCRSHKWKKHPELASKEDETESSRVPVPTLEELR 458
            ..|.  :|.: |.:|.:.|..|:..:||..|.|...::::...:.......|||.|:
  Fly   305 RTHD--QPKLCCPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871
C2H2 Zn finger 273..294 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 5/19 (26%)
C2H2 Zn finger 330..350 CDD:275368 2/19 (11%)
C2H2 Zn finger 357..377 CDD:275368 3/19 (16%)
C2H2 Zn finger 385..405 CDD:275368 9/19 (47%)
zf-H2C2_2 397..422 CDD:290200 8/25 (32%)
C2H2 Zn finger 413..429 CDD:275368 4/15 (27%)
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511
C2H2 Zn finger 201..222 CDD:275368 7/20 (35%)
C2H2 Zn finger 259..279 CDD:275368 3/19 (16%)
C2H2 Zn finger 287..307 CDD:275368 9/19 (47%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009990
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.