DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and CG9932

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_609599.1 Gene:CG9932 / 34701 FlyBaseID:FBgn0262160 Length:2171 Species:Drosophila melanogaster


Alignment Length:425 Identity:80/425 - (18%)
Similarity:127/425 - (29%) Gaps:132/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ELGSMLCE---ECYSVIGQLITFSDSVSKVQAIFELLRHSEPQDSQDLDALRLEYGLPP------ 104
            :.||.|.|   |.:. :.||:......:.|.|:...::..:.|..|.:.....|.|||.      
  Fly    54 QAGSSLLERHVERFR-LQQLLQQQRQAAAVVAVVNSVQQQQQQQPQQVGMDAKEEGLPQCKIKRN 117

  Fly   105 -ACKQDLEFL-----------DIDDTE---DRC-----------SLVEELTISDHSTSPSPDFEA 143
             :|.....|.           |:...:   ::|           .||..:.:....|...|....
  Fly   118 YSCNHCAYFTQNPRYHLTHLRDVHGEKIVINKCKLCLYASRHFQKLVRHMKMVHGCTDGIPSGHG 182

  Fly   144 QT-----VRTRANLKQCNSDPKVLA--SPTASIPEVET-----------------------KRSR 178
            |.     :...|..::......|:.  |.|.::|:|.|                       :|.|
  Fly   183 QARGKRGMSREARKRRLEESVGVMGGQSLTVTVPDVPTLEQVKRELLLQEEKLQRDIQAFNQRQR 247

  Fly   179 RQQFAAKRNSKVYTATESDDEE-AILDEDEAVSP--PPLKRKRGRPKGSGKQKNVDDSDNVTSRE 240
            .:|...::......||.:.:.: .:|.:.|..||  ||                 ..|....|..
  Fly   248 EEQQREQQRELELVATSAYERQMQVLRDYERQSPAEPP-----------------TPSPTSGSAT 295

  Fly   241 PDDNAKSKQDDKTSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHC 305
            |..|.:..|:....                  |..|..|.:....||.|:...||..|.:.||.|
  Fly   296 PPSNGEEPQNRLLK------------------CSACEFTTLYRTQLRAHELAEHGKTKFFRCDKC 342

  Fly   306 GKGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVHSQTHGEPKFECNVCGKKLQTRAIL 370
                    |.|.|                    .|||...|.:.|..|..:|..|..:...:..|
  Fly   343 --------SYVTH--------------------IKARFSKHVKYHSMPMIKCVTCDFRTPYKWNL 379

  Fly   371 NKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGH 405
            ::|...|.....|||..|........:|.:|.:.|
  Fly   380 DRHMKNHGGAGAFKCAACDFTADIKQSLTVHEMNH 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 9/33 (27%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
zf-H2C2_2 397..422 CDD:290200 3/9 (33%)
C2H2 Zn finger 413..429 CDD:275368
CG9932NP_609599.1 C2H2 Zn finger 339..359 CDD:275368 10/47 (21%)
C2H2 Zn finger 366..386 CDD:275368 4/19 (21%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 816..836 CDD:275370
C2H2 Zn finger 844..862 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.