DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and CG11695

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:586 Identity:127/586 - (21%)
Similarity:197/586 - (33%) Gaps:195/586 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRLCARDDVVYKVR--ERDD--------DLVRIISKCFDVEMTLEEPELGSMLCEECYSVIGQLI 66
            ||||. ||..:.|.  ::||        :|..:|.|...: :.|....:...||.:|:..:....
  Fly     3 CRLCL-DDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQL-VLLPNDGVSKSLCTQCWQQLADFE 65

  Fly    67 TFSDSVSKVQAIFELLRHSEPQDSQDLDA-----LRLEYGLPPACKQDLEFLDID---DTEDRCS 123
            .|...|.|.|...:.|:.....:.:|.|.     ...|..:.||...:.|..:||   .:..|.|
  Fly    66 QFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASSNSRSS 130

  Fly   124 LVEELTISDHSTSPSPDFEAQTVRTRANLKQCNSDPKVLASPTASIPEVETKRSRRQQFAAKRNS 188
            .:...::.: ...|||      :|.|..|      |:.:.:|            :.|...||..:
  Fly   131 SIRTTSLRE-MRLPSP------IRRRMRL------PRAVTAP------------KTQAVKAKART 170

  Fly   189 KVYTATESDDEEAILDEDEAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPD----------- 242
            |.:.|...:||:|                    :|.|.    .:|.:..|||.|           
  Fly   171 KTHKAEADEDEDA--------------------EGEGD----PESRSSNSREMDSYIALHGRLEC 211

  Fly   243 ----------DNAKSKQDDKTSELSMS------------------PHGSQSSNFVDYPCKICNET 279
                      :.|:.|:..:....|:.                  .|.....|:  :.||||::.
  Fly   212 CICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNY--FRCKICSKQ 274

  Fly   280 FMSFMALRRHKHDMHGGPKK----YVCDHCGKGLKTFTSLVEHQLVHTEEK-------------- 326
            .:|.::...|....|  |.|    :.||.|.|.......|..|..||.:|:              
  Fly   275 LVSRISYDVHMLRFH--PNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTA 337

  Fly   327 ----------------PCICPVCNAGFKNKARLRVHSQT-HGE----PKFECNVCGKKLQTRAIL 370
                            |.||..|.|.||.|..|.||.:| |.|    |:.:|..|...|.....|
  Fly   338 VDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSL 402

  Fly   371 NKHKYVHTDE---RRFKCEVCG------------------------SGC----KNSTALKIHLLG 404
            .||.|:|.|.   |::|||.||                        :.|    |:|.:|:.|...
  Fly   403 RKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTAT 467

  Fly   405 HTGLRPYVCKYCGKAFASNTNCRSHKWKKHPELASKEDETESSRVPVPTLEELRAITREMAKAKQ 469
            |||...|.|.:|.:.|.::.|...|:.:.|             ...|..|::.:.:.....|.|.
  Fly   468 HTGQDLYECAFCERTFKNSGNMHKHRRQMH-------------AAQVAALQQQKKVPPSKRKDKG 519

  Fly   470 D 470
            |
  Fly   520 D 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 20/77 (26%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 10/20 (50%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 9/47 (19%)
zf-H2C2_2 397..422 CDD:290200 9/24 (38%)
C2H2 Zn finger 413..429 CDD:275368 4/15 (27%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 20/79 (25%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 0/20 (0%)
C2H2 Zn finger 357..376 CDD:275368 9/18 (50%)
C2H2 Zn finger 389..409 CDD:275368 7/19 (37%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.