DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and CG11696

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:619 Identity:134/619 - (21%)
Similarity:205/619 - (33%) Gaps:204/619 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRLCARD-----DVVYKVRERDDDLVRIISKCFDVEMTL---EEPELGSMLCEECYSVIGQLITF 68
            ||||..|     .:..:.........|.:::..:..:.|   |...:.:.||..|:..:.::..|
  Fly     3 CRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQF 67

  Fly    69 SDSVSKVQ-----------AIFELLRHSEPQDSQDLDALRLEYGLPP-------------ACKQD 109
            ...|::.|           .:.||...:||:.:  |.....|..:.|             .|:..
  Fly    68 CSMVAEKQRSLHRSLQLKTELPELPELTEPEPA--LVVWNTESPIEPKLSYEGDDIKDHILCEPV 130

  Fly   110 LEFLDIDDTEDRCSLVEELTISDHSTSPSPDFEAQT------------VRTRAN-------LKQC 155
            ::.|...|.:|          ||:..:..||||.::            |:.|..       |:|.
  Fly   131 IDALSAGDEKD----------SDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQT 185

  Fly   156 N-----SDPKVLASPTASIPEVETKRSRRQQFAAKRNSKVYTATESDDEEAILDEDE-------- 207
            :     ...|......|.|.|:..:.||.:|...||:|    |...||::.  ||||        
  Fly   186 HQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSS----AGAEDDQDG--DEDEEDEEDVGG 244

  Fly   208 -----AVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPDDNAKSKQDD---------------- 251
                 |...|..:.|||||| :.|....||:|: ||..|...:..|:.|                
  Fly   245 ELTPDADEQPKPRGKRGRPK-TKKLVTADDNDD-TSEVPVKRSSIKEMDDYIAANVKLDCAICAA 307

  Fly   252 ------------------------------------------------------------KTSEL 256
                                                                        .:..:
  Fly   308 PLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVM 372

  Fly   257 SMSPHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHCGKGLKTFTSLVEH-QL 320
            .|....||....| :.|.||...|.....|..|.....|..:..|||.|.|..:|...|..| :.
  Fly   373 HMLRFHSQQQELV-HQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKR 436

  Fly   321 VHTEE-KPCICPVCNAGFKNKAR-------------------------------LRVHSQTH--- 350
            :|..: .|.||.:|...|::||.                               ||.|...|   
  Fly   437 MHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDR 501

  Fly   351 -GEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLRPYVCK 414
             |:.|:.|.:|..:..:||.|:.|...|...:|.||.:|....|...||..|:..|||:..|.|:
  Fly   502 DGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQ 566

  Fly   415 YCGKAFASNTNCRSHKWKKHP-ELASKEDETESS 447
            :|.:.|.|:.|..:||.|.|| :...|..:..||
  Fly   567 FCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSS 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 14/86 (16%)
C2H2 Zn finger 273..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
C2H2 Zn finger 330..350 CDD:275368 8/50 (16%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..429 CDD:275368 5/15 (33%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 14/74 (19%)
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 1/20 (5%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 3/19 (16%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.