DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wek and Y37E11B.1

DIOPT Version :9

Sequence 1:	NP_001260472.1	Gene:	wek / 48785	FlyBaseID:	FBgn0001990	Length:	470	Species:	Drosophila melanogaster
Sequence 2:	NP_001023441.1	Gene:	Y37E11B.1 / 177118	WormBaseID:	WBGene00021374	Length:	167	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	54/136 - (39%)
Similarity:	72/136 - (52%)	Gaps:	3/136 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   302 CDHCGKGLKTFTSLVEHQLVHTE-EKPCICPVCNAGFKNKARLRVHSQTHGEPK--FECNVCGKK 363
            |:.||:.||:..||.:|:.:|.| |:...|..|...|.|...||.|...|..||  ..|.|||||
Worm    14 CEICGRILKSDESLRKHERIHDEAERKLECSTCQKRFHNAELLRKHQIVHDIPKKSIICEVCGKK 78

  Fly   364 LQTRAILNKHKYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLRPYVCKYCGKAFASNTNCRS 428
            ..:::.|.|||..|..::||.|.:|.:....|...||||..|..|:|:.|.||.|.|:|.:.||.
Worm    79 YSSKSALAKHKRTHETDKRFTCPMCYASFDLSDPFKIHLRKHDNLKPFGCSYCFKQFSSRSVCRR 143

  Fly   429 HKWKKH 434
            |....|
Worm   144 HVQLMH 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wek	NP_001260472.1	zf-AD	11..80	CDD:214871
		C2H2 Zn finger	273..294	CDD:275368
		C2H2 Zn finger	302..322	CDD:275368	8/19 (42%)
		C2H2 Zn finger	330..350	CDD:275368	7/19 (37%)
		C2H2 Zn finger	357..377	CDD:275368	10/19 (53%)
		C2H2 Zn finger	385..405	CDD:275368	7/19 (37%)
		zf-H2C2_2	397..422	CDD:290200	12/24 (50%)
		C2H2 Zn finger	413..429	CDD:275368	8/15 (53%)
Y37E11B.1	NP_001023441.1	C2H2 Zn finger	14..34	CDD:275368	8/19 (42%)
		C2H2 Zn finger	43..63	CDD:275368	7/19 (37%)
		C2H2 Zn finger	72..92	CDD:275368	10/19 (53%)
		C2H2 Zn finger	100..120	CDD:275368	7/19 (37%)
		C2H2 Zn finger	128..145	CDD:275368	8/16 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910