DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and F58G1.2

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001254358.1 Gene:F58G1.2 / 174931 WormBaseID:WBGene00010264 Length:500 Species:Caenorhabditis elegans


Alignment Length:485 Identity:89/485 - (18%)
Similarity:146/485 - (30%) Gaps:193/485 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DIDDTEDRCSLVEELTISDHSTSPSPDFEAQTVRTRANLKQC--NSDPKVLASPTASIPEVETKR 176
            :|.|.||  ||.|:    ||                |..:.|  ..:.:::||..|.    :.::
 Worm     5 EIVDRED--SLSED----DH----------------AEHRDCQDEKEQQIIASFNAQ----DAQQ 43

  Fly   177 SRR-QQFAAKRNSKVYTATESDD---------EEAILDEDEAV----SPPPLKRKR------GRP 221
            .|| |:...:...|..|..|::|         .:.:....|.:    :||.:.::|      |||
 Worm    44 IRRIQEHFLQECMKKETVAEANDSGRNDVCCPRKKLTGVGELLASLRNPPKIHKERIILGGDGRP 108

  Fly   222 KGSGKQKN-----VDDS---DNVTSREPDDNAKSKQDDKTSELSMSPHGSQSSNFVD-------Y 271
            ....::..     :|.|   |....|:      .:||....:|:|.|..|.|.:.:.       :
 Worm   109 IKKLRENRAALNFIDPSAELDKCIVRQ------KQQDFCAPDLNMVPASSLSIDEIRNAVRKSMF 167

  Fly   272 PCKICNETFMSFMALRRHKHDMHGGPKKYV---------CDHCGK-------------------- 307
            .||:|...|.....|.||..|.|  ||.|:         .|:.|:                    
 Worm   168 RCKVCKNRFGEMSLLERHLRDSH--PKAYIAFLENQREMADYMGELERERNRIEELVSGGFIPPE 230

  Fly   308 ---------------------------------GLKTFTSLVEHQLVHTEEKPCICPVCNAGFKN 339
                                             ||......:..:..:.:::...||.|:..|:|
 Worm   231 SEIEATSNNLEVDSIPLPGENSQGHIPRLNRYGGLMYPMDALRKKFPYLKKRSPQCPFCDKRFRN 295

  Fly   340 KARLRVH-SQTHGE--------------------PKFECNV------------------------ 359
            ......| ::.|.|                    |..:|::                        
 Worm   296 DISFNNHLTKKHPECAEFVQCLHCFKCLPSAADLPTHDCDLTYLCLDCRPIRNMCNGYRLFRHRT 360

  Fly   360 --------------CGKKLQTRAILNKH-KYVHTDERRFKCEVCGSGCKNSTALKIHLLGHTGLR 409
                          |.:|..|...|.|| |..|...|.|:|..|.....:.||:.||...|||:.
 Worm   361 KFHRGYHSGFRCPDCNQKFLTPRKLRKHRKMAHVFSRTFQCHFCEEFFISDTAVTIHERVHTGIL 425

  Fly   410 PYVCKYCGKAFASNTNCRSHKWKKHPELAS 439
            .:.|..|....:.......|..:.|..:.|
 Worm   426 KFECTVCDFRASRYLQMEEHTKEHHGYMCS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871
C2H2 Zn finger 273..294 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 4/72 (6%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 8/58 (14%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 8/24 (33%)
C2H2 Zn finger 413..429 CDD:275368 2/15 (13%)
F58G1.2NP_001254358.1 bZIP <186..222 CDD:304365 7/37 (19%)
C2H2 Zn finger 372..393 CDD:275368 7/20 (35%)
C2H2 Zn finger 401..421 CDD:275368 6/19 (32%)
C2H2 Zn finger 429..449 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.