DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wek and blmp-1

DIOPT Version :9

Sequence 1:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:447 Identity:100/447 - (22%)
Similarity:153/447 - (34%) Gaps:130/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SVIGQLITFSDSVSKVQAIFELLRHSEPQDSQDLDALRLEYGLPPACKQDLEFLDIDDTEDRCSL 124
            |:...::....||.|:        ...|.|:...||         :...|.|.:|:::.|.....
 Worm   280 SLAETIVAIDYSVKKL--------IESPIDTLSTDA---------SSASDEEMIDVEEQESCTRP 327

  Fly   125 VEELT--------------------------ISDHSTSPSPDFEAQTVRTRANLKQCNSDPKVLA 163
            |.|:|                          :.:...||..||: :.:|....||..  |..:..
 Worm   328 VAEVTRPNVIQNPVVRPVATKVNNFPGIPVRLGNFYASPLVDFK-EFMRKSLQLKLV--DTSMFV 389

  Fly   164 SPTASIPEVETKRSRR----------------------------QQFAAKRNSKVYTATESDDEE 200
            ||.|......|....|                            |.|..:.:..:||        
 Worm   390 SPVAQTTAAITATGGRSGQPIDVQPVLAATAGAHFGNYAAIYGSQDFQHELSKPLYT-------- 446

  Fly   201 AILDEDEAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTS--REPDDNAKSKQDDKTSELSMSPHGS 263
                   :.||     ..|...|.|....:..|.:.:|  :.|..|..|...:.:|...:..:..
 Worm   447 -------SASP-----AFGGGGGMGGGFGMGGSAHTSSFHQLPFVNHSSSSHNDSSFNGVPNYVQ 499

  Fly   264 QSSN-FVDYPCKICNETFMSFMALRRHKHDMHGGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKP 327
            |..| ...|.||.||:||.....|:.|.. .|.|.:.:.|:.|.|.......|.:|.||||.|:|
 Worm   500 QQENGKTRYACKDCNKTFGQLSNLKVHVR-THTGERPFKCEICTKEFTQLAHLQKHHLVHTGERP 563

  Fly   328 CICPVCNAGFKNKARLRVHSQTH-GEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSG 391
            ..|.:|:..|.:.:.|:.|.:.| |:..:.|:||..|..        :|||              
 Worm   564 HRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFT--------QYVH-------------- 606

  Fly   392 CKNSTALKIHLLGHTGLRPYVCKYCGKAFASNTNCRSHKWKKHPELASKEDETESSR 448
                  |::|...|...|||.|..|||.:.|.:..|:| ||  .....:||..:|.|
 Worm   607 ------LRLHKRLHANERPYSCGTCGKKYISPSGLRTH-WK--TTTCKEEDMKDSMR 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 4/19 (21%)
C2H2 Zn finger 273..294 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..405 CDD:275368 2/19 (11%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..429 CDD:275368 6/15 (40%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 9/22 (41%)
C2H2 Zn finger 510..530 CDD:275368 8/20 (40%)
zf-H2C2_2 522..547 CDD:290200 7/25 (28%)
C2H2 Zn finger 538..558 CDD:275368 6/19 (32%)
zf-H2C2_2 550..575 CDD:290200 11/24 (46%)
C2H2 Zn finger 566..586 CDD:275368 5/19 (26%)
zf-H2C2_2 578..603 CDD:290200 8/32 (25%)
C2H2 Zn finger 594..614 CDD:275368 9/47 (19%)
zf-H2C2_2 606..631 CDD:290200 11/44 (25%)
ARS2 <620..772 CDD:282772 14/38 (37%)
C2H2 Zn finger 622..641 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.