DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant35A and GALNT16

DIOPT Version :10

Sequence 1:NP_652069.2 Gene:Pgant35A / 48775 FlyBaseID:FBgn0001970 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_065743.2 Gene:GALNT16 / 57452 HGNCID:23233 Length:558 Species:Homo sapiens


Alignment Length:79 Identity:21/79 - (26%)
Similarity:32/79 - (40%) Gaps:23/79 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PTGELSDGTLCKVSGWGNTHNPDESALVLRAATVPLTNHQQCSEVYEGIGSVTE---SMICAGYD 219
            |||:||      |..|             |...|..||::...:|.|.|.::.:   |.:.|.. 
Human   158 PTGQLS------VVPW-------------RRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEI- 202

  Fly   220 EGGKDSCQGDSGGP 233
            :|..|:|...:|.|
Human   203 QGVIDACVKLTGMP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant35ANP_652069.2 pp-GalNAc-T 151..450 CDD:133004 21/79 (27%)
beta-trefoil_Ricin_GALNT11 478..609 CDD:467318
GALNT16NP_065743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54
Catalytic subdomain A 122..227 21/79 (27%)
pp-GalNAc-T 126..420 CDD:133004 21/79 (27%)
Catalytic subdomain B 286..348
beta-trefoil_Ricin_GALNT16 426..557 CDD:467357
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.