DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant35A and CG10000

DIOPT Version :9

Sequence 1:NP_652069.2 Gene:Pgant35A / 48775 FlyBaseID:FBgn0001970 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster


Alignment Length:500 Identity:169/500 - (33%)
Similarity:264/500 - (52%) Gaps:71/500 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HAFNALVSNNIGLFRAIPDTRHKVCDRQETTEAENLP-----QASIVMCFYNEHKMTLMRSIKTV 171
            :.:|..:||.:||.|.:|.|||..|    ||....||     ..|:|:.|:||.:..|:|:|.::
  Fly    73 YQYNIHLSNALGLIRKLPVTRHHSC----TTRNSILPAPLEANVSVVISFHNEARSMLLRTIVSL 133

  Fly   172 LERTPSYLLREIILVDDHSD-----LPELEFHLHGDLRARLKYDNLRYIKNEQREGLIRSRVIGA 231
            |.|:|...|.|:|||||.|.     |.:|:..:.|...:|.:. .|.:::|::|.|||.||..||
  Fly   134 LSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRL-GLTFLRNQERMGLIWSRNRGA 197

  Fly   232 REAVGDVLVFLDSHIEVNQQWLEPLLRLIKSENATLAV-PVIDLINADTFEYTP-SPLVRGGFNW 294
            ..|.|..::|||||.|||:.||||||..: :.|..||| |::|.|:..|..|.. :.|::|||:|
  Fly   198 SLASGRYVLFLDSHCEVNEGWLEPLLERL-ALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDW 261

  Fly   295 GLHFRWENLPEGTLKVPEDFRGPFRSPTMAGGLFAVNRKYFQHLGEYDMAMDIWGGENIEISFRA 359
            .|||.|   .:..|...|....|::||..|||:..::|::|..||.::..:.|||||:||::.:.
  Fly   262 SLHFHW---LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKL 323

  Fly   360 WQCGGAIKIVPCSRVGHIFRKRRPYTSPDGAN--------TMLKNSLRLAHVWMDQYKD--YYLK 414
            |.|||.|:||||||:|||||:|..:..|..::        |.|.||..:|..|:|:||:  |.|:
  Fly   324 WLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALR 388

  Fly   415 --HEKVPKTYDYGDISDRLKLRERLQCRDFAWYLKNVYPELHVPGEESKKSAAAPIFQP---WHS 474
              ..::|..:.|.::.   ::|:..:|..|.|||::|.|||.:..:|  .||...:...   .|:
  Fly   389 PAARRIPLDHTYDELQ---RMRKERRCHPFEWYLRHVSPELRMHFDE--LSATGTLRNEDRCVHA 448

  Fly   475 RKRN--------YVDTF----QLRLTG-----TELCAAVVAPKVKGFWKKGSSLQLQTCRRTP-- 520
            |:::        |:...    .||.:|     .|||.||      ||   |..:.|:.|.|..  
  Fly   449 RQKDSQPILASCYLSDITQWSMLRQSGQLSTHRELCLAV------GF---GMRIALEPCGRNETV 504

  Fly   521 --NQLWYETEKAEIVLDKLLCLEASGDAQVTVNKCHEMLGDQQWR 563
              :|.|.......:..:..|||:.....::.::.|......|.::
  Fly   505 RRSQRWVRLGTHLLHAESHLCLDNPLKDRLEMSTCRSHAVSQSFQ 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant35ANP_652069.2 pp-GalNAc-T 151..450 CDD:133004 123/317 (39%)
RICIN 489..610 CDD:214672 19/83 (23%)
RICIN 490..609 CDD:238092 18/77 (23%)
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 123/316 (39%)
Ricin_B_lectin 435..548 CDD:279046 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.