DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant35A and galnt3

DIOPT Version :9

Sequence 1:NP_652069.2 Gene:Pgant35A / 48775 FlyBaseID:FBgn0001970 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_002936794.2 Gene:galnt3 / 100488466 XenbaseID:XB-GENE-954414 Length:625 Species:Xenopus tropicalis


Alignment Length:663 Identity:215/663 - (32%)
Similarity:324/663 - (48%) Gaps:120/663 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQIKRLLCKSCGLGTLLVAVVW---LLALLFYSHSLRSSIRSAGWRIDE--------------- 47
            |..:||||     ||...:.  |   .:.|:|.............|..||               
 Frog     1 MANLKRLL-----LGRRFIH--WKLGFITLIFMGFLFMIQKEVIDWEKDELGAHRGKKKMLDMMM 58

  Fly    48 ------GNATPRAELSYQARVTVG------CTPNASITTGESPAAPKPPSDPEQLELLG------ 94
                  .::.|:.:::...|.|..      |.|.........|...:||.||......|      
 Frog    59 EAVNNIKDSMPKMQINAPVRQTDNGDNVRPCLPGYYTAAELKPFLERPPQDPHAPGAAGKPFKEE 123

  Fly    95 -VVRNKQDKYIRDIGYKHHAFNALVSNNIGLFRAI-PDTRHKVCDRQETTEAENLPQASIVMCFY 157
             :...:|::  ::.|.|.|.|||..::.|.|.|.: ||||...|..|:......||..||::.|:
 Frog   124 KLTPEEQEE--KERGEKKHCFNAFATDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSIIIVFH 186

  Fly   158 NEHKMTLMRSIKTVLERTPSYLLREIILVDDHSDLPELEFHLHGDLRARLK-YDNLRYIKNEQRE 221
            ||...||:|::.:|:..:|:.||:|||||||.|    ::.:|..:|...:| ...::.::.::|:
 Frog   187 NEAWSTLLRTVYSVMHTSPAILLKEIILVDDAS----VDEYLKDELDEYVKQLQIVKVVRQKERK 247

  Fly   222 GLIRSRVIGAREAVGDVLVFLDSHIEVNQQWLEPLLRLIKSENATLAVPVIDLINADTFEYT-PS 285
            |||.:|::||..|.||.|.|||:|.|....||||||..|.....::..|.|..|:.:||::: ||
 Frog   248 GLITARLLGASVATGDTLTFLDAHCECYYGWLEPLLARIAENYTSVVSPDITGIDLNTFQFSNPS 312

  Fly   286 PL----VRGGFNWGLHFRWENLPEGTLKVPEDFRGPFRSPTMAGGLFAVNRKYFQHLGEYDMAMD 346
            |.    .||.|:|.|.|.||:||.......:|...|.::||.|||||::::.||:|:|.||..|:
 Frog   313 PYGNNHNRGNFDWTLSFGWESLPSSEKTRRKDETYPIKTPTFAGGLFSISKAYFEHIGSYDEQME 377

  Fly   347 IWGGENIEISFRAWQCGGAIKIVPCSRVGHIFRKRRPYTSPDGANTMLKNSLRLAHVWMDQYKDY 411
            ||||||||:|||.|||||.::|:|||.|||:||.:.|:|.|.|...:::|.:|||.||||..|:.
 Frog   378 IWGGENIEMSFRVWQCGGQLEILPCSVVGHVFRSKSPHTFPKGTQVIVRNQVRLAEVWMDDLKEI 442

  Fly   412 YLKHEK----VPKTYDYGDISDRLKLRERLQCRDFAWYLKNVYPELHVPGEESKKSAAAPIFQPW 472
            :.:..:    :.|:.:|||:|.||.||.||||::|.|||.|:|||::||                
 Frog   443 FYRRNREAANIVKSKEYGDLSKRLDLRHRLQCKNFTWYLNNIYPEMYVP---------------- 491

  Fly   473 HSRKRNYVDTFQLRLTGTELCAAVVAPKVKGFWKKGSS-LQLQTCRRTPNQLWYE-TEKAEI--V 533
               :|:.:....|:..|.:||..|      |....|.. |.:.:|.......::| |.|.||  .
 Frog   492 ---ERHPLIHGDLKNVGRDLCLDV------GGENHGDKPLIMYSCHGLGGNQYFEYTSKHEIRHN 547

  Fly   534 LDKLLCLEASGDAQVTVNKCH------EMLGDQQWRHTRN--ANSPVYNMAKGTCLRAAAPTTGA 590
            :.|.|||..| .:.:.:..|:      ..|.:::|...|.  ..:|.||                
 Frog   548 IQKELCLRPS-HSSLVIKPCNYRGRDTAPLPEERWELQREQLLFNPSYN---------------- 595

  Fly   591 LISLDLCSKSNGA 603
                 ||..|.||
 Frog   596 -----LCVSSEGA 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant35ANP_652069.2 pp-GalNAc-T 151..450 CDD:133004 136/308 (44%)
RICIN 489..610 CDD:214672 30/127 (24%)
RICIN 490..609 CDD:238092 29/126 (23%)
galnt3XP_002936794.2 pp-GalNAc-T 180..485 CDD:133004 136/308 (44%)
Ricin_B_lectin 498..619 CDD:366226 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.