DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Egfem1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006535622.1 Gene:Egfem1 / 75740 MGIID:1922990 Length:658 Species:Mus musculus


Alignment Length:228 Identity:50/228 - (21%)
Similarity:65/228 - (28%) Gaps:97/228 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CCPGY------RTILFGFCEPV--------CQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQL 131
            |..||      ||.:..|....        |...|...:..|   ||.|..||:.|..       
Mouse   253 CDTGYRRHADERTCIISFLSETDPCAGANGCAHLCQTENGMA---RCACHAGYQLSED------- 307

  Fly   132 ICRPVCQ--GGCPEH-----SHCVAHN---ECECWPGFK---DASSWFSLSLR----CER----- 174
              :..|:  ..|.|.     .|||...   .|.|.|||:   |....:.:.|.    ||:     
Mouse   308 --KKACEDINECAEELAPCAHHCVNSKGSFTCTCHPGFELGADRKHCYRIELEIVNICEKNNGGC 370

  Fly   175 ------------VQCGHEQRFD-------------PGRRACVQI--------EMSMEELMQRVA- 205
                        ..|.|..:.|             .|...|.|:        |.|.||..|..: 
Mouse   371 SHHCEPAIGGAHCSCNHGHQLDTDGKTCIDFDECESGEACCAQLCINYLGGYECSCEEGFQISSD 435

  Fly   206 ----ERLAKGLEAEEE-----------AANEPE 223
                :.|.:.||.|||           |.|.|:
Mouse   436 GCGCDALDEQLEEEEEEIDILRFPGRLAQNPPQ 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 40/200 (20%)
Egfem1XP_006535622.1 EMI 71..140 CDD:369419
FXa_inhibition 190..225 CDD:373209
vWFA <213..265 CDD:381780 3/11 (27%)
vWFA <268..310 CDD:381780 10/53 (19%)
vWFA <308..350 CDD:381780 12/41 (29%)
FXa_inhibition 363..398 CDD:373209 5/34 (15%)
vWFA <395..436 CDD:381780 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.