DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and tnfaip6

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:60 Identity:14/60 - (23%)
Similarity:21/60 - (35%) Gaps:20/60 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RWDNIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLIC 133
            |||   |.|          ..||.:|....|:   :|::.....||...:.    .:.||
Zfish   132 RWD---VYC----------YNPVAKECGGVHT---DPEKVLVSPGYPDEYQ----DEQIC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 5/18 (28%)
CUB 145..254 CDD:395345 6/34 (18%)

Return to query results.
Submit another query.