DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NimC3 and STAB2

DIOPT Version :9

Sequence 1:	NP_524928.2	Gene:	NimC3 / 48772	FlyBaseID:	FBgn0001967	Length:	224	Species:	Drosophila melanogaster
Sequence 2:	NP_060034.9	Gene:	STAB2 / 55576	HGNCID:	18629	Length:	2551	Species:	Homo sapiens

Alignment Length:	140	Identity:	39/140 - (27%)
Similarity:	55/140 - (39%)	Gaps:	43/140 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    81 CCPGYRTILFG---FCEPV--C-QEACPAHSYCA--EPDR--CHCQRGYEPSHHHTTGHQLICRP 135
            |.|.||    |   :|:|:  | ::.|..|::|.  .|:|  |.||.||.       |...:|.|
Human   224 CLPNYR----GDGKYCDPINPCLRKICHPHAHCTYLGPNRHSCTCQEGYR-------GDGQVCLP 277

  Fly   136 V--CQ---GGCPEHSHCVAH-----NECECWPGFKDASSWFSLSLR--------CER-VQCGHEQ 181
            |  ||   |.||..|....:     :.|||...:::.......|:.        |.| ..|   .
Human   278 VDPCQINFGNCPTKSTVCKYDGPGQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANC---T 339

  Fly   182 RFDPGRRACV 191
            ...|||..|:
Human   340 TVAPGRTECI 349

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NimC3	NP_524928.2	MSC	85..>212	CDD:286487	37/136 (27%)
STAB2	NP_060034.9	EGF_3	246..275	CDD:289699	11/35 (31%)
		EGF_3	326..361	CDD:289699	7/27 (26%)
		Fasciclin	382..505	CDD:280607
		Fasciclin	526..654	CDD:280607
		EGF_3	837..865	CDD:289699
		EGF_3	920..951	CDD:289699
		EGF_3	957..993	CDD:289699
		Fasciclin	1009..1129	CDD:280607
		Fasciclin	1148..1265	CDD:280607
		EGF_3	1437..1469	CDD:289699
		EGF_3	1475..1511	CDD:289699
		EGF_3	1517..1553	CDD:289699
		EGF_3	1559..1595	CDD:289699
		Fasciclin	1617..1726	CDD:280607
		Fasciclin	1752..1882	CDD:280607
		EGF_3	2086..2121	CDD:289699
		EGF_3	2127..2164	CDD:289699
		Link_domain_TSG_6_like	2198..2290	CDD:239592
		FAS1	2356..2449	CDD:214719
		Interaction with TMSB4X. /evidence=ECO:0000269\|PubMed:18519035	2504..2514
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2512..2551
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1218
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900