DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and eater

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster


Alignment Length:79 Identity:32/79 - (40%)
Similarity:43/79 - (54%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGCPEHS 145
            |..|| |.|.|.|.|||::.| .:.:||.|::|.|..|||....:.      |.|||.||| ::.
  Fly   283 CNAGY-TKLEGVCTPVCKDGC-VNGFCASPEKCSCNDGYEMDSENR------CSPVCSGGC-KNG 338

  Fly   146 HCVAHNECECWPGF 159
            .|||..:|.|..|:
  Fly   339 FCVAPGKCSCDEGY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 30/75 (40%)
eaterNP_651533.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.