DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Scarf1

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001004157.2 Gene:Scarf1 / 380713 MGIID:2449455 Length:820 Species:Mus musculus


Alignment Length:128 Identity:37/128 - (28%)
Similarity:49/128 - (38%) Gaps:38/128 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CCPGYR------TILFGFCEPVCQ--EACPAHSYCAEPDRCHCQRGYE--------PSHHHTTGH 129
            ||||:|      ||      |:|:  :||.....|.:|..|.|:.|:.        |..:  .||
Mouse    44 CCPGWRQKDQECTI------PICEGPDACRKEEVCVKPGLCRCKPGFFGAQCSSRCPGQY--WGH 100

  Fly   130 QLICRPVCQGGCPEHSHC-VAHNECECWPGFKDASSWFSLSLRCE-RVQCGHEQRFDPGRRAC 190
            .  ||..|.  |.....| .|..:|:|.|.:     |..|   || ...||...:.||....|
Mouse   101 D--CRETCP--CHPRGQCEPATGDCQCQPNY-----WGRL---CEFPCTCGPHGQCDPKTGLC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
Scarf1NP_001004157.2 PHA03247 <541..781 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 549..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..820
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.