DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and CG15861

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:60/174 - (34%) Gaps:55/174 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLVLMTIHLVEVSSLAITNGHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSYVVYEERVRW 75
            :||:.|...|...::...||.|.::.|    .|.|...|||       :|   |..|...|    
  Fly    41 MLVVNTRQCVRRCNIVCLNGVCFEDGS----CPCADQYMAG-------NP---DGLVCAAE---- 87

  Fly    76 DNIQVCCPGYRTILFGFC----------------EPV---CQEACP----------AHSYCAEPD 111
                 |.||. ....|:|                :|:   |:...|          .|..|:...
  Fly    88 -----CLPGC-VAAGGYCAAPDLCVCREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHGNCSSDG 146

  Fly   112 RCHCQRGYEPSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECEC 155
            ||.|.:|||.......|.|  |.|:|...|...::|.|.|.|.|
  Fly   147 RCICAQGYELRDSLLHGQQ--CMPICDHNCGPRAYCFAPNLCAC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 24/100 (24%)
CG15861NP_001286863.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.