DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimC4

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster


Alignment Length:239 Identity:69/239 - (28%)
Similarity:108/239 - (45%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVLVLMTIHLVEVSSLAITNGHCQKNISVKYQVPVAKTRMAGAGPP-----NASHPIDLDSYVVY 69
            |:|||.:|     ::.|..:.:|::|.:::..|||.|.|:....|.     ..:..| .:.|...
  Fly     7 LILVLGSI-----AANAERDNYCERNETIRATVPVTKQRIIVKQPSKWKIWKKTEKI-TEIYDSE 65

  Fly    70 EERVRWDNIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICR 134
            ||:|....::.|||||..:..|.|||:|...||||:.||.||||.|..||..:.:|..|.. .|.
  Fly    66 EEQVTHRLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSH-YCE 129

  Fly   135 PVCQGGCPEHSHCVAHNECECWPGF------KDASSWFSLSL----------RC---ERVQCGHE 180
            |:|:..||..:.||..|.|.|..|:      .|..|.....:          :|   :|..|...
  Fly   130 PICETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDVDRCACNSG 194

  Fly   181 QRFDPGRRACVQIEMSMEELMQRVAERLAKGLEAEEEAANEPES 224
            .|:|.....|:::.          ||.:::.||..|:..:.|.:
  Fly   195 YRWDKAEERCIELS----------AESISEELETTEDNTDSPST 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 42/145 (29%)
NimC4NP_609698.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 1 1.000 - - FOG0020207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.