DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimB1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:47/112 - (41%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECECW 156
            ||.|.|.::|..|..|..|.:|.|..||..:      ..|.|:|||...| ....|||.|:|||:
  Fly   175 FCRPKCSQSCGTHEECVAPGQCDCSPGYRRT------PDLGCQPVCAPDC-GFGKCVAPNQCECF 232

  Fly   157 PGFKDASSW----FSLSLRCE--------RVQCGHEQRFDPGRRACV 191
            .||....:|    ....|.||        :..|....|:|....:|:
  Fly   233 AGFIKRPNWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 35/112 (31%)
NimB1NP_001260452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.