DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimA

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:250 Identity:57/250 - (22%)
Similarity:98/250 - (39%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLQQVLYPMLVLVL-MTIHL----------------VEVSSLAITNGHCQKNISVK-------YQ 41
            |:::.|:..|:|:| |.:.|                :|...:|:.:.....||.::       .|
  Fly     1 MIREKLFGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQ 65

  Fly    42 VP-VAKTRMAGAG-----PPN-ASHPIDLDSYVVYEERVRWDNIQVCCPGYRTILF---GFCEPV 96
            || :...|:..:.     ||. |:...::...:..::..:...::.||.||...|.   ..|:|:
  Fly    66 VPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPI 130

  Fly    97 CQEACPAHSYCAEPDRCHCQRGYEPSH------HHTTGHQLICRPVCQ----GGCPEHS---HCV 148
            |:..|...| |..||.|.|:.||...|      |...|  |.|:.:||    ..|...|   ||:
  Fly   131 CRGGCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWG--LDCKNLCQCQNGAACDNKSGLCHCI 192

  Fly   149 A---HNECE--CWPGFKDASSWFSLSLRCERVQCGHEQRFDPGRRACVQIEMSME 198
            |   ...||  |..|        :..:.|.:.....|:..:|...||:|.:..::
  Fly   193 AGWTGQFCELPCPQG--------TYGIMCRKACDCDEKPCNPQTGACIQQDQPLQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 36/134 (27%)
NimANP_001285918.1 EMI 52..116 CDD:284877 11/63 (17%)
EGF_2 170..200 CDD:285248 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.