DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and dkk1b

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_571078.1 Gene:dkk1b / 30197 ZFINID:ZDB-GENE-990708-5 Length:241 Species:Danio rerio


Alignment Length:263 Identity:50/263 - (19%)
Similarity:72/263 - (27%) Gaps:120/263 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MLVLVLMTIHLVEVSSLAITNGHCQKNISVKYQVPVAKTRMAGAGPPNASHPID-------LDSY 66
            |.:.:|.|..|:.:..:.:.......:.::|          .|:|...:|||:.       |||.
Zfish     2 MHIAMLSTACLIFMGCIKVAGSTMLNSNAIK----------VGSGAAGSSHPVSPSPDVSPLDSL 56

  Fly    67 ----------VVYE-----------------------ERVRWDNIQVCCPGYRTILFGFCEP--- 95
                      ::.|                       .|.|.....:|||| .....|.|.|   
Zfish    57 NFALDTPQQPLICESDEECGGEEFCFQSRGVCLQCKKRRKRCIRDAMCCPG-NHCSNGVCIPNDP 120

  Fly    96 -VCQ--------------------------------------EACPAHSYCAEPDRCHCQRGYEP 121
             :.|                                      |.|...|.||| ..| |.|.:  
Zfish   121 DIIQQLGMEEFVSIAHENSTALMPKVSTQGSPQNQMLKGLEGENCLRSSDCAE-TLC-CARHF-- 181

  Fly   122 SHHHTTGHQLICRPVCQGG--CPEHSHCVAH-----NECECWPGFKDASSWFSLSLRCERVQCGH 179
                   ...||:||.:.|  |.:|.....|     ..|:|..|         ||.|.:|...|.
Zfish   182 -------WSKICKPVLKEGQVCTKHKRKGTHGLEIFQRCDCGEG---------LSCRTQRGDGGK 230

  Fly   180 EQR 182
            ..|
Zfish   231 ASR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 30/147 (20%)
dkk1bNP_571078.1 Dickkopf_N 69..116 CDD:282549 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.