DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Dkk2

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:255 Identity:54/255 - (21%)
Similarity:83/255 - (32%) Gaps:99/255 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLVLMTIHLVEVSSLAITNGHCQKNISVKY----QVPV-AKTRMAG------------------A 52
            :|:|..:.:||.|.|:.:..   |..|:|.    :.|. |..|.||                  |
  Rat    14 LLLLAAVLMVESSQLSSSRA---KLNSIKSSLGGETPAQAANRSAGMNQGLAFGGSKKGKSLGQA 75

  Fly    53 GPPNASHPIDLDSY------------VVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEA----C 101
            .|.::....::..|            |...::.|.....:||||.| ...|.|.||.:..    .
  Rat    76 YPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPGTR-CNNGICIPVTESILTPHI 139

  Fly   102 PAHSYCAEPDRCHCQRGYEPSHH--------------HTTGHQ---------------------- 130
            ||.......||.|   |:..:|.              |..||:                      
  Rat   140 PALDGTRHRDRNH---GHYSNHDLGWQNLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCARHFWT 201

  Fly   131 LICRPVCQGG--CPEHSHCVAH-----NECECWPG-----FKDASSWFSLSLR---CERV 175
            .||:||...|  |.:.....:|     ..|:|..|     :|||:  :|...|   |:::
  Rat   202 KICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDAT--YSSKARLHVCQKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 31/146 (21%)
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.