DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Dkk1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:273 Identity:51/273 - (18%)
Similarity:70/273 - (25%) Gaps:136/273 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLMTIHLVEVSSLAITN---------GHCQKNISV----------KYQV-------PVAKTRMAG 51
            |..|::.|.::|.||.|         |.....:||          |||.       |.|:....|
  Rat    29 VSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECG 93

  Fly    52 AGPPNASHPIDLDSY------------------VVYEERVRWDNIQVCCPGYRTILFGFCEPVCQ 98
            .           |.|                  ...:.|.|.....:||||      .:|:    
  Rat    94 T-----------DEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPG------NYCK---- 137

  Fly    99 EACPAHSYCAEPDRCHCQRG-------------------------YEPSHHHTTGHQ-------- 130
                 :..|...|..|..||                         .....:||.|.:        
  Rat   138 -----NGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSS 197

  Fly   131 --------------LICRPVCQGG--CPEHSHCVAH-----NECECWPGFKDASSWFSLSLRCER 174
                          .||:||.:.|  |.:|....:|     ..|.|..|           |.| |
  Rat   198 DCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEG-----------LAC-R 250

  Fly   175 VQCGHEQRFDPGR 187
            :|..|.|..:..|
  Rat   251 IQKDHHQTSNSSR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 27/157 (17%)
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 11/81 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.