DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Megf10

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001094127.1 Gene:Megf10 / 291445 RGDID:735084 Length:1145 Species:Rattus norvegicus


Alignment Length:181 Identity:39/181 - (21%)
Similarity:59/181 - (32%) Gaps:72/181 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HPIDLDSYVVYEERVRWDNIQVCCPGY---RTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE 120
            |.:...:...:.|:..:.....||||:   |.:    |.|.|.:.| .|..|..|:.|.|:.|:.
  Rat    72 HRVSYRTAYRHGEKTMYRRKSQCCPGFYESRDV----CVPHCADKC-VHGRCIAPNTCQCEPGWG 131

  Fly   121 PSH-------HHTTGH---------QLICRPV--------------CQGGCPE-------HSHCV 148
            .::       .|...|         :.:|.|:              |:..|.:       |..|.
  Rat   132 GTNCSSACDGDHWGPHCSSRCQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQ 196

  Fly   149 AHN---------ECECWPGFKDASSWFSLSLRCERV--------QCGHEQR 182
            ..|         ||.|.||:..|.        ||.:        ||  |||
  Rat   197 CQNGATCDHITGECRCSPGYTGAF--------CEDLCPPGKHGPQC--EQR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
Megf10NP_001094127.1 EMI 31..100 CDD:462204 6/27 (22%)
EGF_Lam 281..318 CDD:214543
EGF_CA 542..587 CDD:473889
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.