DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimB2

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:204 Identity:50/204 - (24%)
Similarity:73/204 - (35%) Gaps:69/204 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AITNGHCQKNISVKYQVPVAKTRMAGAG-PPNASHPIDLDSYVVYEERVRWDNIQVCCPGY--RT 87
            |:.:|.|.|.:.....:..::.:..|.| .|:.|                  .|||||.||  ..
  Fly   129 AMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMS------------------RIQVCCDGYERNP 175

  Fly    88 ILFGFCEPVCQEAC--------------PAH------------------SYCAEPDRCHCQRGY- 119
            .::..|||:|.:.|              |.|                  ..|.|.:.|.|:.|| 
  Fly   176 HIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYS 240

  Fly   120 -EPSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERV--QCGHEQ 181
             ||.      .:..|:|.|:.|| ....|||.|:|.|..|::.|:..     .||.|  .|.:.:
  Fly   241 LEPE------TRKYCQPECKPGC-SFGRCVAPNKCACLDGYRLAADG-----SCEPVCDSCENGK 293

  Fly   182 RFDPGRRAC 190
            ...||...|
  Fly   294 CTAPGHCNC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 36/144 (25%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.