Sequence 1: | NP_524928.2 | Gene: | NimC3 / 48772 | FlyBaseID: | FBgn0001967 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723857.1 | Gene: | NimB2 / 260645 | FlyBaseID: | FBgn0028543 | Length: | 421 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 50/204 - (24%) |
---|---|---|---|
Similarity: | 73/204 - (35%) | Gaps: | 69/204 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 AITNGHCQKNISVKYQVPVAKTRMAGAG-PPNASHPIDLDSYVVYEERVRWDNIQVCCPGY--RT 87
Fly 88 ILFGFCEPVCQEAC--------------PAH------------------SYCAEPDRCHCQRGY- 119
Fly 120 -EPSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERV--QCGHEQ 181
Fly 182 RFDPGRRAC 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimC3 | NP_524928.2 | MSC | 85..>212 | CDD:286487 | 36/144 (25%) |
NimB2 | NP_723857.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D97941at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24047 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |