DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and STAB1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:264 Identity:56/264 - (21%)
Similarity:76/264 - (28%) Gaps:115/264 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CQKNISVK-----------YQVPVAKTRMAGAGPPNASHPIDLDSY-----VVYEERVRWDNIQV 80
            |:|.:..|           ::.|      .||..|...|...||..     .|.:|..|....|.
Human    91 CRKQVVQKACCPGYWGSRCHECP------GGAETPCNGHGTCLDGMDRNGTCVCQENFRGSACQE 149

  Fly    81 C---------CPGYRTILFGFCE------------------------PVCQE-ACPAHSYC-AEP 110
            |         |....:.:.|.|.                        ||||| .||.::.| ||.
Human   150 CQDPNRFGPDCQSVCSCVHGVCNHGPRGDGSCLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEA 214

  Fly   111 DRCHCQRGYE-----------------------------------PSHHHTTGHQLICRP--VCQ 138
            ..|.|..||.                                   |.::|  |..::|.|  .|.
Human   215 PSCRCLPGYTQQGSECRAPNPCWPSPCSLLAQCSVSPKGQAQCHCPENYH--GDGMVCLPKDPCT 277

  Fly   139 ---GGCPEHSHCVAHNE-----CECWPGFKDASS-------WFSLSLRCER-VQCGHEQRFDPGR 187
               ||||.:|....:.:     |.|.||....:|       .|.....|:| ..|   |....|:
Human   278 DNLGGCPSNSTLCVYQKPGQAFCTCRPGLVSINSNASAGCFAFCSPFSCDRSATC---QVTADGK 339

  Fly   188 RACV 191
            .:||
Human   340 TSCV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 40/186 (22%)
STAB1XP_016861487.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.