DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and DKK1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:265 Identity:55/265 - (20%)
Similarity:79/265 - (29%) Gaps:113/265 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YPMLVLVLMTIHLVEVSSLAITN---------GHCQKNISV----------KYQV-------PVA 45
            :|:|. |..|::.| ::|.||.|         ||....:|.          |||.       |.|
Human    24 HPLLG-VSATLNSV-LNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCA 86

  Fly    46 KTRMAGAGPPNASHPIDLDSYV-----VYEERVRWDNIQVCCPGYRTILFGFCEPVCQEACPAHS 105
            :....|.....||.....|:.|     ..:.|.|.....:||||      .:|:         :.
Human    87 EDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPG------NYCK---------NG 136

  Fly   106 YCAEPDRCHCQ------------------RGY------EPSHHHTTGHQ---------------- 130
            .|...|:.|.:                  .||      ....:||.|.:                
Human   137 ICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCC 201

  Fly   131 ------LICRPVCQGG--CPEHSHCVAH-----NECECWPGFKDASSWFSLSLRCERVQCGHEQR 182
                  .||:||.:.|  |.:|....:|     ..|.|..|           |.| |:|..|.|.
Human   202 ARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEG-----------LSC-RIQKDHHQA 254

  Fly   183 FDPGR 187
            .:..|
Human   255 SNSSR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 27/156 (17%)
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 13/68 (19%)
DKK-type Cys-1 85..138 13/67 (19%)
DKK-type Cys-2 189..263 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.