DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Scarf2

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_036015777.1 Gene:Scarf2 / 224024 MGIID:1858430 Length:838 Species:Mus musculus


Alignment Length:189 Identity:43/189 - (22%)
Similarity:59/189 - (31%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GAGP------------------PNASHPIDLDSYVVYEERVRWDNIQVCCPGYRTILFGFCEPVC 97
            ||||                  |..:.|.||:.......|.....:..||.|:|.:.......||
Mouse     8 GAGPARRQGARGLGLLLLLWLLPGLAAPQDLNPRGRNVCRTPGSQVLTCCAGWRQLGDECGIAVC 72

  Fly    98 Q--EACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGCPEHSH---------CVAH- 150
            :  ..|..:..|..|..|.|:.||..::..|...:....|.|:..|..|.|         |..| 
Mouse    73 EGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKERCSCHPHGQCEDVTGQCTCHA 137

  Fly   151 --------NECECWPGFKDASSWFSLSLRCE----------RVQCGHEQRFDPGRRACV 191
                    :.|:|..|.....|.   :.|||          ...|....|.||...||:
Mouse   138 RRWGARCEHACQCQHGTCHPRSG---ACRCEPGWWGAQCASACYCSATSRCDPQTGACL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 31/137 (23%)
Scarf2XP_036015777.1 exchanger_TraA <74..431 CDD:411343 28/123 (23%)
PHA03307 526..>836 CDD:223039
PHA03247 <683..838 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.