DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Megf11

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001395541.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus


Alignment Length:186 Identity:47/186 - (25%)
Similarity:58/186 - (31%) Gaps:75/186 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SHPIDLDSYVVYEERVRWDNI----------------------QVCCPGYRTILFGFCEPVCQEA 100
            :||.|...|....:.:.|...                      ..|||||.. ...||.|:|.|.
Mouse    42 AHPFDQIYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYE-NGDFCIPLCTEE 105

  Fly   101 CPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGC-PEH--SHCVAHNECE-------- 154
            | .|..|..||.|||:.|:.             .|.|..|| .||  .||....:|:        
Mouse   106 C-MHGRCVSPDTCHCEPGWG-------------GPDCSSGCDSEHWGPHCSNRCQCQNGALCNPI 156

  Fly   155 -----CWPGFKDASSWFSLSLRCERV--------------QCGHEQRFDPGRRACV 191
                 |.|||:   .|     |||.:              ||.|....||....|:
Mouse   157 TGACVCAPGFR---GW-----RCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
Megf11NP_001395541.1 EMI 24..93 CDD:462204 10/50 (20%)
EGF_CA 188..233 CDD:473889 6/17 (35%)
EGF_CA 274..319 CDD:473889
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.