DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and M03F4.6

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:216 Identity:48/216 - (22%)
Similarity:74/216 - (34%) Gaps:65/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GHCQKNISVKYQVP-VAKTRMAGAGPPNASHPIDLDSYVVYEERVRWDNIQVCCPGYR-----TI 88
            |||.: :...|..| ::::..|||.|.:...|:....:.|.|.  .|.: .:|||  |     |.
 Worm   216 GHCCR-LRCPYGEPDLSQSCDAGASPDSKCRPLTHFCFTVSEP--GWKS-SLCCP--RPCRDPTP 274

  Fly    89 LF--GFCEPVCQ--EACPAHSYC-------AEPDRCHCQRGYEPSHHHTTGHQLICRPVC----- 137
            |:  |.|..:..  :.|.....|       .....|.|:.||   |.:.....|.|...|     
 Worm   275 LYVNGQCLSIAHRGDPCQIDQQCEGGITMSCTLGSCQCKLGY---HENNDERFLTCTKDCTLEEV 336

  Fly   138 ----------QGG--CPEHSHCVAHNE-----CECWPGFKDASSWFSLSLRCERVQCGHEQRFDP 185
                      |.|  |..:..|:...|     |:|..|:|...... |.:||....       ||
 Worm   337 ASNDRCLAKVQLGARCYSNKQCIQSAECRFGTCQCRCGYKQVKDQL-LGVRCTNPD-------DP 393

  Fly   186 GRRACVQIEMSMEELMQRVAE 206
                     :|:..::.||.:
 Worm   394 ---------LSIGSILDRVGD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 32/160 (20%)
M03F4.6NP_508843.1 EB 113..160 CDD:279949
EB 272..321 CDD:279949 11/51 (22%)
EB 331..381 CDD:279949 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.