DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Dkk1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:272 Identity:53/272 - (19%)
Similarity:73/272 - (26%) Gaps:138/272 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TIHLVEVSSLAITN---------GHCQKNISV----------KYQV-------PVAKTRMAGAGP 54
            |::.|.::|.||.|         |.....:||          |||.       |.|:....|:  
Mouse    32 TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGS-- 94

  Fly    55 PNASHPIDLDSY------------------VVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEAC 101
                     |.|                  ...:.|.|.....:||||      .:|:       
Mouse    95 ---------DEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPG------NYCK------- 137

  Fly   102 PAHSYCAEPDRCHCQRG-YEPS--------H------------------HHTTGHQ--------- 130
              :..|...|..|..|| .|.|        |                  :||.|.:         
Mouse   138 --NGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSD 200

  Fly   131 -------------LICRPVCQGG--CPEHSHCVAH-----NECECWPGFKDASSWFSLSLRCERV 175
                         .||:||.:.|  |.:|....:|     ..|.|..|           |.| |:
Mouse   201 CAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEG-----------LAC-RI 253

  Fly   176 QCGHEQRFDPGR 187
            |..|.|..:..|
Mouse   254 QKDHHQASNSSR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 30/159 (19%)
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 11/81 (14%)
DKK-type Cys-1 86..141 11/80 (14%)
DKK-type Cys-2 195..269 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.