DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and pear1

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_017952446.2 Gene:pear1 / 100489801 XenbaseID:XB-GENE-6045593 Length:1087 Species:Xenopus tropicalis


Alignment Length:145 Identity:42/145 - (28%)
Similarity:54/145 - (37%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HPIDLDSYVVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSH 123
            |.:.||    |..|. |     ||.||.. ....|.|.|.:.| .|..|..||:|.|:.|:....
 Frog    80 HRVKLD----YRRRY-W-----CCKGYYE-SNDICVPRCTQEC-VHGRCIAPDQCQCEPGWRGKD 132

  Fly   124 HHTTGHQLICRPVCQGGCP--EHSHC-VAHNECECWPGFKD---------ASSWFSLSLRCERVQ 176
            ..:.....:..|.|...||  .:..| .|...|.|.|||:|         .:.....||.|   |
 Frog   133 CSSACEAHVWGPKCNSTCPCQNNGACDAASGTCICPPGFRDPFCEKPCDPGTYGGGCSLSC---Q 194

  Fly   177 CGHEQRFDPGRRACV 191
            |.:....||...||:
 Frog   195 CKNGAECDPENGACL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 33/119 (28%)
pear1XP_017952446.2 EMI 29..97 CDD:400092 9/26 (35%)
exchanger_TraA <147..>310 CDD:411343 19/66 (29%)
exchanger_TraA <416..729 CDD:411343
Laminin_EGF 546..586 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.